SMURF1 (SMAD specific E3 ubiquitin protein ligase 1)

Gene

• Entrez ID: 57154
• Gene name: SMAD specific E3 ubiquitin protein ligase 1
• Gene symbol: SMURF1
• Synonyms: -
• Chromosome: 7
• Chromosome location: 7q22.1
• Summary: This gene encodes a ubiquitin ligase that is specific for receptor-regulated SMAD proteins in the bone morphogenetic protein (BMP) pathway. This protein plays a key roll in the regulation of cell motility, cell signalling, and cell polarity. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Dec 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006796	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	21898695
MIRT042442	hsa-miR-424-5p	CLASH	23622248
MIRT054756	hsa-miR-497-5p	Luciferase reporter assay, Immunohistochemistry, Western blot	24858688
MIRT054796	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24435757
MIRT054796	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT726480	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT726481	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT726482	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT733581	hsa-miR-140-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27214554

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IBA	21873635
GO:0000209	Process	Protein polyubiquitination	IDA	19937093
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	10458166, 19937093
GO:0005515	Function	Protein binding	IPI	15231748, 19914168, 19937093, 20580715, 21382345, 21572392, 22020285, 23032291, 25249323
GO:0005543	Function	Phospholipid binding	TAS	22020285
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	11278251, 12151385, 21572392
GO:0005739	Component	Mitochondrion	IGI	22020285
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	12151385
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	10458166, 12151385, 19937093
GO:0006611	Process	Protein export from nucleus	IDA	11278251
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS
GO:0007398	Process	Ectoderm development	TAS	10458166
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0016567	Process	Protein ubiquitination	IDA	11278251
GO:0030154	Process	Cell differentiation	IDA	10458166
GO:0030424	Component	Axon	IEA
GO:0030509	Process	BMP signaling pathway	IDA	21572392
GO:0030509	Process	BMP signaling pathway	TAS
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	11278251, 12151385
GO:0030514	Process	Negative regulation of BMP signaling pathway	IBA	21873635
GO:0030514	Process	Negative regulation of BMP signaling pathway	IDA	27214554
GO:0030514	Process	Negative regulation of BMP signaling pathway	TAS	10458166
GO:0030579	Process	Ubiquitin-dependent SMAD protein catabolic process	IBA	21873635
GO:0030579	Process	Ubiquitin-dependent SMAD protein catabolic process	IDA	11278251, 12151385
GO:0032801	Process	Receptor catabolic process	IDA	12151385
GO:0034394	Process	Protein localization to cell surface	IDA	12151385
GO:0043025	Component	Neuronal cell body	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	11278251
GO:0045732	Process	Positive regulation of protein catabolic process	IBA	21873635
GO:0048185	Function	Activin binding	NAS	16720724
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	11278251, 12151385
GO:0061630	Function	Ubiquitin protein ligase activity	TAS
GO:0061736	Process	Engulfment of target by autophagosome	IMP	22020285
GO:0061753	Process	Substrate localization to autophagosome	IMP	22020285
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070411	Function	I-SMAD binding	IPI	11278251, 12151385
GO:0070412	Function	R-SMAD binding	IPI	11278251
GO:0071211	Process	Protein targeting to vacuole involved in autophagy	IMP	22020285
GO:0072659	Process	Protein localization to plasma membrane	TAS	22020285
GO:1903861	Process	Positive regulation of dendrite extension	IDA	23999003
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IMP	21454619

Other IDs

• MIM: 605568
• HGNC: 16807
• e!Ensembl: ENSG00000198742

Protein

• UniProt ID: Q9HCE7
• Protein name: E3 ubiquitin-protein ligase SMURF1 (hSMURF1) (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase SMURF1) (SMAD ubiquitination regulatory factor 1) (SMAD-specific E3 ubiquitin-protein ligase 1)
• Protein function: E3 ubiquitin-protein ligase that acts as a negative regulator of BMP signaling pathway. Mediates ubiquitination and degradation of SMAD1 and SMAD5, 2 receptor-regulated SMADs specific for the BMP pathway. Promotes ubiquitination and subsequent proteasomal degradation of TRAF family members and RHOA. Promotes ubiquitination and subsequent proteasomal degradation of MAVS (PubMed:23087404). Plays a role in dendrite formation by melanocytes (PubMed:23999003).
• PDB: 2LAZ, 2LB0, 2LB1, 2LTX, 3PYC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00168	C2	13 → 115	C2 domain	Domain
  PF00397	WW	236 → 265	WW domain	Domain
  PF00397	WW	308 → 337	WW domain	Domain
  PF00632	HECT	449 → 757	HECT-domain (ubiquitin-transferase)	Domain

• Sequence:

  MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDP
  KWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCK
  LNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPA
  PYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGY
  EQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAAFLYEFLLQGHTSEPRDLNSV
  NCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPS
  EGSLEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMR
  PKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSS
  INPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLV
  WILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGI
  EAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVR
  WFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLP
  KAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE

• Sequence length: 757