SLC8A3 (solute carrier family 8 member A3)

Gene

• Entrez ID: 6547
• Gene name: Solute carrier family 8 member A3
• Gene symbol: SLC8A3
• Synonyms: NCX3
• Chromosome: 14
• Chromosome location: 14q24.2
• Summary: This gene encodes a member of the sodium/calcium exchanger integral membrane protein family. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner. Alternative splicing has been observed for this gene and multiple variants have been described. [provided by RefSeq, Aug 2013]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT525945	hsa-miR-874-5p	PAR-CLIP	22012620
MIRT525945	hsa-miR-874-5p	PAR-CLIP	20371350
MIRT525946	hsa-miR-5699-5p	PAR-CLIP	22012620
MIRT525946	hsa-miR-5699-5p	PAR-CLIP	20371350
MIRT525947	hsa-miR-298	PAR-CLIP	22012620
MIRT525947	hsa-miR-298	PAR-CLIP	20371350
MIRT525948	hsa-miR-5008-5p	PAR-CLIP	22012620
MIRT525948	hsa-miR-5008-5p	PAR-CLIP	20371350
MIRT525949	hsa-miR-6868-5p	PAR-CLIP	22012620
MIRT525949	hsa-miR-6868-5p	PAR-CLIP	20371350
MIRT525950	hsa-miR-8073	PAR-CLIP	22012620
MIRT525951	hsa-miR-221-5p	PAR-CLIP	22012620
MIRT525952	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT525952	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT525953	hsa-miR-759	PAR-CLIP	22012620
MIRT525953	hsa-miR-759	PAR-CLIP	20371350
MIRT525954	hsa-miR-4257	PAR-CLIP	22012620
MIRT525954	hsa-miR-4257	PAR-CLIP	20371350
MIRT525955	hsa-miR-6847-5p	PAR-CLIP	22012620
MIRT525955	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT525956	hsa-miR-5000-5p	PAR-CLIP	22012620
MIRT525956	hsa-miR-5000-5p	PAR-CLIP	20371350
MIRT525957	hsa-miR-6769a-3p	PAR-CLIP	22012620
MIRT525957	hsa-miR-6769a-3p	PAR-CLIP	20371350

Transcription factors

Transcription factor	Regulation	Reference
KCNIP3	Repression	16306395

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0005432	Function	Calcium:sodium antiporter activity	IBA	21873635
GO:0005432	Function	Calcium:sodium antiporter activity	ISS
GO:0005516	Function	Calmodulin binding	IEA
GO:0005741	Component	Mitochondrial outer membrane	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	ISS
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	ISS
GO:0006811	Process	Ion transport	TAS
GO:0006851	Process	Mitochondrial calcium ion transmembrane transport	ISS
GO:0006874	Process	Cellular calcium ion homeostasis	ISS
GO:0007154	Process	Cell communication	IEA
GO:0007611	Process	Learning or memory	ISS
GO:0007612	Process	Learning	ISS
GO:0007613	Process	Memory	ISS
GO:0014069	Component	Postsynaptic density	ISS
GO:0014819	Process	Regulation of skeletal muscle contraction	ISS
GO:0015491	Function	Cation:cation antiporter activity	IBA	21873635
GO:0016020	Component	Membrane	IBA	21873635
GO:0016528	Component	Sarcoplasm	IEA
GO:0021537	Process	Telencephalon development	IEA
GO:0030001	Process	Metal ion transport	IBA	21873635
GO:0030424	Component	Axon	IBA	21873635
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	ISS
GO:0031226	Component	Intrinsic component of plasma membrane	IDA	21959935
GO:0031594	Component	Neuromuscular junction	ISS
GO:0035725	Process	Sodium ion transmembrane transport	IBA	21873635
GO:0035725	Process	Sodium ion transmembrane transport	ISS
GO:0042383	Component	Sarcolemma	IBA	21873635
GO:0042383	Component	Sarcolemma	ISS
GO:0042552	Process	Myelination	ISS
GO:0043025	Component	Neuronal cell body	ISS
GO:0043197	Component	Dendritic spine	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043679	Component	Axon terminus	ISS
GO:0045202	Component	Synapse	IDA	21382638
GO:0045202	Component	Synapse	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	21959935
GO:0048709	Process	Oligodendrocyte differentiation	ISS
GO:0050808	Process	Synapse organization	ISS
GO:0051560	Process	Mitochondrial calcium ion homeostasis	ISS
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0070588	Process	Calcium ion transmembrane transport	ISS
GO:0071320	Process	Cellular response to cAMP	IEA
GO:0071456	Process	Cellular response to hypoxia	ISS
GO:0071901	Process	Negative regulation of protein serine/threonine kinase activity	ISS
GO:0098703	Process	Calcium ion import across plasma membrane	IBA	21873635
GO:0098794	Component	Postsynapse	IBA	21873635
GO:0098815	Process	Modulation of excitatory postsynaptic potential	ISS
GO:0099055	Component	Integral component of postsynaptic membrane	IEA
GO:0099566	Process	Regulation of postsynaptic cytosolic calcium ion concentration	IEA
GO:0099580	Function	Ion antiporter activity involved in regulation of postsynaptic membrane potential	IEA
GO:1903779	Process	Regulation of cardiac conduction	TAS
GO:1905060	Function	Calcium:cation antiporter activity involved in regulation of postsynaptic cytosolic calcium ion concentration	IEA
GO:1990034	Process	Calcium ion export across plasma membrane	IEA

Other IDs

• MIM: 607991
• HGNC: 11070
• e!Ensembl: ENSG00000100678

Protein

• UniProt ID: P57103
• Protein name: Sodium/calcium exchanger 3 (Na(+)/Ca(2+)-exchange protein 3) (Solute carrier family 8 member 3)
• Protein function: Mediates the electrogenic exchange of Ca(2+) against Na(+) ions across the cell membrane, and thereby contributes to the regulation of cytoplasmic Ca(2+) levels and Ca(2+)-dependent cellular processes. Contributes to cellular Ca(2+) homeostasis in excitable cells, both in muscle and in brain. In a first phase, voltage-gated channels mediate the rapid increase of cytoplasmic Ca(2+) levels due to release of Ca(2+) stores from the endoplasmic reticulum. SLC8A3 mediates the export of Ca(2+) from the cell during the next phase, so that cytoplasmic Ca(2+) levels rapidly return to baseline. Contributes to Ca(2+) transport during excitation-contraction coupling in muscle. In neurons, contributes to the rapid decrease of cytoplasmic Ca(2+) levels back to baseline after neuronal activation, and thereby contributes to modulate synaptic plasticity, learning and memory (By similarity). Required for normal oligodendrocyte differentiation and for normal myelination (PubMed:21959935). Mediates Ca(2+) efflux from mitochondria and contributes to mitochondrial Ca(2+) ion homeostasis (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01699	Na_Ca_ex	79 → 250	Sodium/calcium exchanger protein	Family
  PF16494	Na_Ca_ex_C	253 → 380	C-terminal extension of sodium/calcium exchanger domain	Family
  PF03160	Calx-beta	385 → 485	Calx-beta domain	Domain
  PF03160	Calx-beta	519 → 619	Calx-beta domain	Domain
  PF01699	Na_Ca_ex	753 → 918	Sodium/calcium exchanger protein	Family

• Sequence:

  MAWLRLQPLTSAFLHFGLVTFVLFLNGLRAEAGGSGDVPSTGQNNESCSGSSDCKEGVIL
  PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
  TSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFI
  IIGICVYVIPDGETRKIKHLRVFFITAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFF
  FPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDGN
  LVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATR
  MMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFISKVFFDPCSYQCLENCGAVLLTVVR
  KGGDMSKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
  FVRLSNVRIEEEQPEEGMPPAIFNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIH
  VSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGELEFKNDETVKTIRV
  KIVDEEEYERQENFFIALGEPKWMERGISALLLSPDVTDRKLTMEEEEAKRIAEMGKPVL
  GEHPKLEVIIEESYEFKTTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDESG
  EERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFAVSILIIGMLTAIIGDLASHFG
  CTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLAW
  SVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLA
  TTWLFVSLWLLYILFATLEAYCYIKGF

• Sequence length: 927