SLC2A4 (solute carrier family 2 member 4)

Gene

• Entrez ID: 6517
• Gene name: Solute carrier family 2 member 4
• Gene symbol: SLC2A4
• Synonyms: GLUT4
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006559	hsa-miR-223-3p	Flow, Immunoblot, Immunofluorescence, Immunohistochemistry, Immunoprecipitaion, In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR	20080987
MIRT019111	hsa-miR-335-5p	Microarray	18185580
MIRT038921	hsa-miR-92a-1-5p	CLASH	23622248
MIRT053085	hsa-miR-93-5p	Luciferase reporter assay, qRT-PCR, Western blot	23493574
MIRT467766	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT467767	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT467768	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT467769	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT467770	hsa-miR-6077	PAR-CLIP	23592263
MIRT467771	hsa-miR-1286	PAR-CLIP	23592263
MIRT467772	hsa-miR-6133	PAR-CLIP	23592263
MIRT467773	hsa-miR-6130	PAR-CLIP	23592263
MIRT467774	hsa-miR-6129	PAR-CLIP	23592263
MIRT467775	hsa-miR-6127	PAR-CLIP	23592263
MIRT467776	hsa-miR-4510	PAR-CLIP	23592263
MIRT467777	hsa-miR-4419a	PAR-CLIP	23592263
MIRT467778	hsa-miR-5000-3p	PAR-CLIP	23592263
MIRT467779	hsa-miR-4436a	PAR-CLIP	23592263
MIRT467780	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT467781	hsa-miR-4739	PAR-CLIP	23592263
MIRT467782	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT467783	hsa-miR-1321	PAR-CLIP	23592263
MIRT467784	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT611332	hsa-miR-3121-5p	HITS-CLIP	27418678
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT611333	hsa-miR-6771-3p	HITS-CLIP	27418678
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT611334	hsa-miR-548as-3p	HITS-CLIP	27418678
MIRT611335	hsa-miR-548z	HITS-CLIP	23824327
MIRT611335	hsa-miR-548z	HITS-CLIP	27418678
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT611336	hsa-miR-548h-3p	HITS-CLIP	27418678
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT611337	hsa-miR-548d-3p	HITS-CLIP	27418678
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT611338	hsa-miR-548bb-3p	HITS-CLIP	27418678
MIRT611339	hsa-miR-548ac	HITS-CLIP	23824327
MIRT611339	hsa-miR-548ac	HITS-CLIP	27418678
MIRT732724	hsa-miR-106b-5p	LacZ reporter assay	27165190

Transcription factors

Transcription factor	Regulation	Reference
HDAC4	Unknown	23899560
HDAC5	Repression	22991226
HDAC5	Unknown	23899560
MEF2A	Activation	14630949;18198354
MEF2A	Unknown	15294043
PPARG	Repression	16670091
SLC2A4RG	Activation	14630949

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005355	Function	Glucose transmembrane transporter activity	ISS
GO:0005515	Function	Protein binding	IPI	19478182, 25910212
GO:0005771	Component	Multivesicular body	IEA
GO:0005802	Component	Trans-Golgi network	IDA	12467732
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	12556481, 19590752
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IEA
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0005975	Process	Carbohydrate metabolic process	TAS	2649253
GO:0007611	Process	Learning or memory	ISS
GO:0007614	Process	Short-term memory	ISS
GO:0007616	Process	Long-term memory	ISS
GO:0009897	Component	External side of plasma membrane	IDA	14562105
GO:0010021	Process	Amylopectin biosynthetic process	IEA
GO:0012505	Component	Endomembrane system	ISS
GO:0012506	Component	Vesicle membrane	IDA	14562105
GO:0016020	Component	Membrane	TAS	2649253
GO:0016529	Component	Sarcoplasmic reticulum	IEA
GO:0030136	Component	Clathrin-coated vesicle	IDA	19478182
GO:0030140	Component	Trans-Golgi network transport vesicle	IEA
GO:0030315	Component	T-tubule	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	ISS
GO:0031550	Process	Positive regulation of brain-derived neurotrophic factor receptor signaling pathway	ISS
GO:0032593	Component	Insulin-responsive compartment	IDA	19590752
GO:0032593	Component	Insulin-responsive compartment	ISS
GO:0032869	Process	Cellular response to insulin stimulus	IBA	21873635
GO:0032869	Process	Cellular response to insulin stimulus	IDA	12556481
GO:0042383	Component	Sarcolemma	ISS
GO:0042593	Process	Glucose homeostasis	IDA	14562105, 17003346
GO:0044381	Process	Glucose import in response to insulin stimulus	ISS
GO:0045121	Component	Membrane raft	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0046323	Process	Glucose import	NAS	11742412
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12556481, 14562105, 19590752
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0055056	Function	D-glucose transmembrane transporter activity	IEA
GO:0070062	Component	Extracellular exosome	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071470	Process	Cellular response to osmotic stress	IEA
GO:0098694	Process	Regulation of synaptic vesicle budding from presynaptic endocytic zone membrane	IEA
GO:0098793	Component	Presynapse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653
GO:1904659	Process	Glucose transmembrane transport	ISS
GO:1904659	Process	Glucose transmembrane transport	TAS	12556481

Other IDs

• MIM: 138190
• HGNC: 11009
• e!Ensembl: ENSG00000181856

Protein

• UniProt ID: P14672
• Protein name: Solute carrier family 2, facilitated glucose transporter member 4 (Glucose transporter type 4, insulin-responsive) (GLUT-4)
• Protein function: Insulin-regulated facilitative glucose transporter, which plays a key role in removal of glucose from circulation. Response to insulin is regulated by its intracellular localization: in the absence of insulin, it is efficiently retained intracellularly within storage compartments in muscle and fat cells. Upon insulin stimulation, translocates from these compartments to the cell surface where it transports glucose from the extracellular milieu into the cell.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00083	Sugar_tr	27 → 483	Sugar (and other) transporter	Family

• Sequence:

  MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW
  LGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV
  LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
  VIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPA
  RKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL
  SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM
  CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
  AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQIS
  AAFHRTPSLLEQEVKPSTELEYLGPDEND

• Sequence length: 509