SLC22A3 (solute carrier family 22 member 3)

Gene

• Entrez ID: 6581
• Gene name: Solute carrier family 22 member 3
• Gene symbol: SLC22A3
• Synonyms: EMT, EMTH, OCT3
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019444	hsa-miR-148b-3p	Microarray	17612493
MIRT021441	hsa-miR-9-5p	Microarray	17612493
MIRT022967	hsa-miR-124-3p	Microarray	18668037
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	23824327
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	23824327
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639284	hsa-miR-1272	HITS-CLIP	23824327
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT666304	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT666305	hsa-miR-4507	HITS-CLIP	23824327
MIRT666306	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT666307	hsa-miR-4291	HITS-CLIP	23824327
MIRT666308	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT666309	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT666310	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT666311	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT713244	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT713245	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT713246	hsa-miR-4330	HITS-CLIP	19536157
MIRT713247	hsa-miR-499b-5p	HITS-CLIP	19536157
MIRT713248	hsa-miR-4494	HITS-CLIP	19536157
MIRT735451	hsa-miR-147a	Luciferase reporter assay	27417586

Transcription factors

Transcription factor	Regulation	Reference
KLF8	Unknown	17671186

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001692	Process	Histamine metabolic process	TAS	23505051
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IDA	20858707
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IMP	23505051
GO:0005330	Function	Dopamine:sodium symporter activity	IEA
GO:0005515	Function	Protein binding	IPI	17474147
GO:0005886	Component	Plasma membrane	IDA	20858707, 23137377
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9933568
GO:0006836	Process	Neurotransmitter transport	IDA	20858707
GO:0006855	Process	Drug transmembrane transport	TAS
GO:0008504	Function	Monoamine transmembrane transporter activity	IDA	20858707
GO:0008504	Function	Monoamine transmembrane transporter activity	IMP	23505051
GO:0008514	Function	Organic anion transmembrane transporter activity	ISS
GO:0015101	Function	Organic cation transmembrane transporter activity	IDA	10966924, 16024787, 22806583, 24291757
GO:0015101	Function	Organic cation transmembrane transporter activity	TAS
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IDA	10966924, 20858707
GO:0015695	Process	Organic cation transport	IDA	10966924, 16024787, 22806583, 24291757
GO:0015697	Process	Quaternary ammonium group transport	IDA	10966924, 20858707
GO:0015711	Process	Organic anion transport	ISS
GO:0015718	Process	Monocarboxylic acid transport	IEA
GO:0015844	Process	Monoamine transport	IMP	23505051
GO:0016020	Component	Membrane	TAS	9933568
GO:0019534	Function	Toxin transmembrane transporter activity	IDA	22806583, 24291757
GO:0032098	Process	Regulation of appetite	IEA
GO:0042908	Process	Xenobiotic transport	IDA	20858707, 22806583, 24291757
GO:0043025	Component	Neuronal cell body	IEA
GO:0051610	Process	Serotonin uptake	IDA	20858707
GO:0051615	Process	Histamine uptake	IDA	20858707
GO:0051615	Process	Histamine uptake	IMP	23505051
GO:0051620	Process	Norepinephrine uptake	IDA	20858707
GO:0051625	Process	Epinephrine uptake	IDA	20858707
GO:0090494	Process	Dopamine uptake	IDA	20858707
GO:0098793	Component	Presynapse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1901998	Process	Toxin transport	IDA	22806583, 24291757

Other IDs

• MIM: 604842
• HGNC: 10967
• e!Ensembl: ENSG00000146477

Protein

• UniProt ID: O75751
• Protein name: Solute carrier family 22 member 3 (Extraneuronal monoamine transporter) (EMT) (Organic cation transporter 3)
• Protein function: Mediates potential-dependent transport of a variety of organic cations. May play a significant role in the disposition of cationic neurotoxins and neurotransmitters in the brain.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07690	MFS_1	142 → 485	Major Facilitator Superfamily	Family

• Sequence:

  MPSFDEALQRVGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGTQPDHYWCRGPSAAALA
  ERCGWSPEEEWNRTAPASRGPEPPERRGRCQRYLLEAANDSASATSALSCADPLAAFPNR
  SAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYG
  RIVIYLLSCLGVGVTGVVVAFAPNFPVFVIFRFLQGVFGKGTWMTCYVIVTEIVGSKQRR
  IVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKK
  GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFT
  SAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVA
  CLVTAFLPEGIAWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFG
  GIIAPFLLFRLAAVWLELPLIIFGILASICGGLVMLLPETKGIALPETVDDVEKLGSPHS
  CKCGRNKKTPVSRSHL

• Sequence length: 556