SLC22A2 (solute carrier family 22 member 2)

Gene

• Entrez ID: 6582
• Gene name: Solute carrier family 22 member 2
• Gene symbol: SLC22A2
• Synonyms: Oct-02
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017635	hsa-miR-335-5p	Microarray	18185580
MIRT1354399	hsa-miR-3152-3p	CLIP-seq
MIRT1354400	hsa-miR-4724-5p	CLIP-seq
MIRT1354401	hsa-miR-4766-5p	CLIP-seq
MIRT1354402	hsa-miR-488	CLIP-seq
MIRT1354399	hsa-miR-3152-3p	CLIP-seq
MIRT2104826	hsa-miR-3622a-3p	CLIP-seq
MIRT2104827	hsa-miR-3622b-3p	CLIP-seq
MIRT2104828	hsa-miR-412	CLIP-seq
MIRT2104829	hsa-miR-4282	CLIP-seq
MIRT2104830	hsa-miR-4659a-3p	CLIP-seq
MIRT2104831	hsa-miR-4659b-3p	CLIP-seq
MIRT1354400	hsa-miR-4724-5p	CLIP-seq
MIRT2104832	hsa-miR-513a-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
USF1	Activation	17314196
USF1	Unknown	18508876

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005275	Function	Amine transmembrane transporter activity	IDA	9687576
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IDA	9687576
GO:0005886	Component	Plasma membrane	IDA	23137377
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9260930
GO:0006836	Process	Neurotransmitter transport	IDA	9687576
GO:0006855	Process	Drug transmembrane transport	TAS
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	ISS
GO:0007269	Process	Neurotransmitter secretion	TAS
GO:0007589	Process	Body fluid secretion	TAS	9260930
GO:0008504	Function	Monoamine transmembrane transporter activity	IDA	9687576
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0015101	Function	Organic cation transmembrane transporter activity	IBA	21873635
GO:0015101	Function	Organic cation transmembrane transporter activity	IDA	9687576, 16024787, 22806583, 24291757
GO:0015101	Function	Organic cation transmembrane transporter activity	IMP	23864433
GO:0015179	Function	L-amino acid transmembrane transporter activity	IMP	23864433
GO:0015214	Function	Pyrimidine nucleoside transmembrane transporter activity	IMP	20477935
GO:0015220	Function	Choline transmembrane transporter activity	IDA	9687576
GO:0015562	Function	Efflux transmembrane transporter activity	IDA	9687576
GO:0015695	Process	Organic cation transport	IBA	21873635
GO:0015695	Process	Organic cation transport	IDA	9687576, 16024787, 22806583, 24291757
GO:0015695	Process	Organic cation transport	IMP	23864433
GO:0015837	Process	Amine transport	IDA	9687576
GO:0015871	Process	Choline transport	IDA	9687576
GO:0016020	Component	Membrane	TAS	9260930
GO:0016324	Component	Apical plasma membrane	IDA	20477935
GO:0019534	Function	Toxin transmembrane transporter activity	IDA	9687576, 22806583, 24291757
GO:0019534	Function	Toxin transmembrane transporter activity	IMP	20477935
GO:0042136	Process	Neurotransmitter biosynthetic process	TAS
GO:0042908	Process	Xenobiotic transport	IDA	9687576, 22806583, 24291757
GO:0042908	Process	Xenobiotic transport	IMP	20477935
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IMP	20477935
GO:0051610	Process	Serotonin uptake	IDA	9687576
GO:0051615	Process	Histamine uptake	IDA	9687576
GO:0051620	Process	Norepinephrine uptake	IDA	9687576
GO:0061459	Function	L-arginine transmembrane transporter activity	IMP	23864433
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0072531	Process	Pyrimidine-containing compound transmembrane transport	IEA
GO:0089718	Process	Amino acid import across plasma membrane	IMP	23864433
GO:0090494	Process	Dopamine uptake	IDA	9687576
GO:0097638	Process	L-arginine import across plasma membrane	IMP	23864433
GO:0098793	Component	Presynapse	IEA
GO:0140115	Process	Export across plasma membrane	IDA	9687576
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1901998	Process	Toxin transport	IDA	9687576, 22806583, 24291757
GO:1901998	Process	Toxin transport	IMP	20477935
GO:1902475	Process	L-alpha-amino acid transmembrane transport	IMP	23864433
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	NAS	20477935

Other IDs

• MIM: 602608
• HGNC: 10966
• e!Ensembl: ENSG00000112499

Protein

• UniProt ID: O15244
• Protein name: Solute carrier family 22 member 2 (Organic cation transporter 2) (hOCT2)
• Protein function: Electrogenic voltage-dependent transporter that mediates the transport of a variety of organic cations such as endogenous bioactive amines, cationic drugs and xenobiotics (PubMed:9260930, PubMed:9687576). Functions as a Na(+)-independent, bidire
• PDB: 8ET9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00083	Sugar_tr	91 → 529	Sugar (and other) transporter	Family

• Sequence:

  MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELS
  LRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLG
  PCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCL
  LTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIF
  YQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAM
  RIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSV
  LYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLA
  SVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGII
  TPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKE
  KMIYLQVQKLDIPLN

• Sequence length: 555