SLC22A1 (solute carrier family 22 member 1)

Gene

• Entrez ID: 6580
• Gene name: Solute carrier family 22 member 1
• Gene symbol: SLC22A1
• Synonyms: HOCT1, OCT1, oct1_cds
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. Two transcript variants encoding two different isoforms have been found for this gene, but only the longer variant encodes a functional transporter. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT646159	hsa-miR-466	HITS-CLIP	23824327
MIRT646160	hsa-miR-4672	HITS-CLIP	23824327
MIRT646161	hsa-miR-3941	HITS-CLIP	23824327
MIRT646162	hsa-miR-4275	HITS-CLIP	23824327
MIRT646163	hsa-miR-4687-5p	HITS-CLIP	23824327
MIRT646164	hsa-miR-6856-3p	HITS-CLIP	23824327
MIRT646165	hsa-miR-6768-5p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005277	Function	Acetylcholine transmembrane transporter activity	IEA
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IDA	24688079
GO:0005330	Function	Dopamine:sodium symporter activity	IEA
GO:0005334	Function	Norepinephrine:sodium symporter activity	IEA
GO:0005515	Function	Protein binding	IPI	11543633, 21988832, 32296183
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9187257
GO:0006836	Process	Neurotransmitter transport	IDA	24688079
GO:0006855	Process	Drug transmembrane transport	TAS
GO:0008504	Function	Monoamine transmembrane transporter activity	IDA	24688079
GO:0008513	Function	Secondary active organic cation transmembrane transporter activity	IEA
GO:0010248	Process	Establishment or maintenance of transmembrane electrochemical gradient	IEA
GO:0015101	Function	Organic cation transmembrane transporter activity	IBA	21873635
GO:0015101	Function	Organic cation transmembrane transporter activity	IDA	22806583, 24291757
GO:0015101	Function	Organic cation transmembrane transporter activity	TAS	9187257
GO:0015214	Function	Pyrimidine nucleoside transmembrane transporter activity	IMP	20477935
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IDA	23567998
GO:0015695	Process	Organic cation transport	IBA	21873635
GO:0015695	Process	Organic cation transport	IDA	22806583, 24291757
GO:0015695	Process	Organic cation transport	TAS	9187257
GO:0015697	Process	Quaternary ammonium group transport	IDA	23567998
GO:0015874	Process	Norepinephrine transport	IDA	24688079
GO:0016020	Component	Membrane	TAS	9187257
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	20477935, 28362799
GO:0019534	Function	Toxin transmembrane transporter activity	IDA	22806583, 24291757
GO:0019534	Function	Toxin transmembrane transporter activity	IMP	20477935
GO:0042802	Function	Identical protein binding	IEA
GO:0042908	Process	Xenobiotic transport	IDA	22806583, 24291757
GO:0042908	Process	Xenobiotic transport	IMP	20477935, 28362799
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IMP	20477935, 28362799
GO:0048241	Process	Epinephrine transport	IEA
GO:0051610	Process	Serotonin uptake	IDA	24688079
GO:0051620	Process	Norepinephrine uptake	IEA
GO:0072531	Process	Pyrimidine-containing compound transmembrane transport	IEA
GO:0090494	Process	Dopamine uptake	IDA	24688079
GO:0098655	Process	Cation transmembrane transport	IEA
GO:0098793	Component	Presynapse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1901374	Process	Acetate ester transport	IEA
GO:1901998	Process	Toxin transport	IDA	22806583, 24291757
GO:1901998	Process	Toxin transport	IMP	20477935
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	NAS	20477935

Other IDs

• MIM: 602607
• HGNC: 10963
• e!Ensembl: ENSG00000175003

Protein

• UniProt ID: O15245
• Protein name: Solute carrier family 22 member 1 (Organic cation transporter 1) (hOCT1)
• Protein function: Translocates a broad array of organic cations with various structures and molecular weights including the model compounds 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), N-1-methylnicotinamide (NMN), 4-(4-(dimethylamino)styryl)-N-methylpyridinium (ASP), the endogenous compounds choline, guanidine, histamine, epinephrine, adrenaline, noradrenaline and dopamine, and the drugs quinine, and metformin. The transport of organic cations is inhibited by a broad array of compounds like tetramethylammonium (TMA), cocaine, lidocaine, NMDA receptor antagonists, atropine, prazosin, cimetidine, TEA and NMN, guanidine, cimetidine, choline, procainamide, quinine, tetrabutylammonium, and tetrapentylammonium. Translocates organic cations in an electrogenic and pH-independent manner. Translocates organic cations across the plasma membrane in both directions. Transports the polyamines spermine and spermidine. Transports pramipexole across the basolateral membrane of the proximal tubular epithelial cells. The choline transport is activated by MMTS. Regulated by various intracellular signaling pathways including inhibition by protein kinase A activation, and endogenously activation by the calmodulin complex, the calmodulin-dependent kinase II and LCK tyrosine kinase.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00083	Sugar_tr	89 → 371	Sugar (and other) transporter	Family

• Sequence:

  MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQ
  RCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
  CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLL
  GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
  QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
  IMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVL
  YQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM
  IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
  PFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
  TIYLKVQTSEPSGT

• Sequence length: 554