SLC22A1 (solute carrier family 22 member 1)

Gene

• Entrez ID: 6580
• Gene name: Solute carrier family 22 member 1
• Gene symbol: SLC22A1
• Synonyms: HOCT1, OCT1, oct1_cds
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT646165	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT646164	hsa-miR-6856-3p	HITS-CLIP	23824327
MIRT646163	hsa-miR-4687-5p	HITS-CLIP	23824327
MIRT646162	hsa-miR-4275	HITS-CLIP	23824327
MIRT646161	hsa-miR-3941	HITS-CLIP	23824327
MIRT646160	hsa-miR-4672	HITS-CLIP	23824327
MIRT646159	hsa-miR-466	HITS-CLIP	23824327
MIRT646165	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT646164	hsa-miR-6856-3p	HITS-CLIP	23824327
MIRT646163	hsa-miR-4687-5p	HITS-CLIP	23824327
MIRT646162	hsa-miR-4275	HITS-CLIP	23824327
MIRT646161	hsa-miR-3941	HITS-CLIP	23824327
MIRT646160	hsa-miR-4672	HITS-CLIP	23824327
MIRT646159	hsa-miR-466	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005277	Function	Acetylcholine transmembrane transporter activity	IEA
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IDA	24688079
GO:0005330	Function	Dopamine:sodium symporter activity	IEA
GO:0005334	Function	Norepinephrine:sodium symporter activity	IEA
GO:0005515	Function	Protein binding	IPI	11543633, 21988832, 32296183
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9187257
GO:0006836	Process	Neurotransmitter transport	IDA	24688079
GO:0006855	Process	Drug transmembrane transport	TAS
GO:0008504	Function	Monoamine transmembrane transporter activity	IDA	24688079
GO:0008513	Function	Secondary active organic cation transmembrane transporter activity	IEA
GO:0010248	Process	Establishment or maintenance of transmembrane electrochemical gradient	IEA
GO:0015101	Function	Organic cation transmembrane transporter activity	IBA	21873635
GO:0015101	Function	Organic cation transmembrane transporter activity	IDA	22806583, 24291757
GO:0015101	Function	Organic cation transmembrane transporter activity	TAS	9187257
GO:0015214	Function	Pyrimidine nucleoside transmembrane transporter activity	IMP	20477935
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IDA	23567998
GO:0015695	Process	Organic cation transport	IBA	21873635
GO:0015695	Process	Organic cation transport	IDA	22806583, 24291757
GO:0015695	Process	Organic cation transport	TAS	9187257
GO:0015697	Process	Quaternary ammonium group transport	IDA	23567998
GO:0015874	Process	Norepinephrine transport	IDA	24688079
GO:0016020	Component	Membrane	TAS	9187257
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	20477935, 28362799
GO:0019534	Function	Toxin transmembrane transporter activity	IDA	22806583, 24291757
GO:0019534	Function	Toxin transmembrane transporter activity	IMP	20477935
GO:0042802	Function	Identical protein binding	IEA
GO:0042908	Process	Xenobiotic transport	IDA	22806583, 24291757
GO:0042908	Process	Xenobiotic transport	IMP	20477935, 28362799
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IMP	20477935, 28362799
GO:0048241	Process	Epinephrine transport	IEA
GO:0051610	Process	Serotonin uptake	IDA	24688079
GO:0051620	Process	Norepinephrine uptake	IEA
GO:0072531	Process	Pyrimidine-containing compound transmembrane transport	IEA
GO:0090494	Process	Dopamine uptake	IDA	24688079
GO:0098655	Process	Cation transmembrane transport	IEA
GO:0098793	Component	Presynapse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1901374	Process	Acetate ester transport	IEA
GO:1901998	Process	Toxin transport	IDA	22806583, 24291757
GO:1901998	Process	Toxin transport	IMP	20477935
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	NAS	20477935

Other IDs

• MIM: 602607
• HGNC: 10963
• e!Ensembl: ENSG00000175003

Protein

• UniProt ID: O15245
• Protein name: Solute carrier family 22 member 1 (Organic cation transporter 1) (hOCT1)
• Protein function: Electrogenic voltage-dependent transporter that mediates the transport of a variety of organic cations such as endogenous bioactive amines, cationic drugs and xenobiotics (PubMed:11388889, PubMed:11408531, PubMed:12439218, PubMed:12719534, PubMe
• PDB: 8ET6, 8ET7, 8ET8, 8JTS, 8JTT, 8JTV, 8JTW, 8JTX, 8JTY, 8JTZ, 8JU0, 8SC1, 8SC2, 8SC3, 8SC4, 8SC6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00083	Sugar_tr	89 → 371	Sugar (and other) transporter	Family

• Sequence:

  MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQ
  RCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
  CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLL
  GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
  QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
  IMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVL
  YQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM
  IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
  PFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
  TIYLKVQTSEPSGT

• Sequence length: 554