GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

SIRT1 (sirtuin 1)

Gene

23411

Sirtuin 1

SIRT1

SIR2, SIR2L1, SIR2alpha

10q21.3

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det

Show/Hide all(364)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002098	hsa-miR-34a-5p	Western blot	18834855
MIRT002098	hsa-miR-34a-5p	Western blot, Luciferase reporter assay, Northern blot	18755897
MIRT002098	hsa-miR-34a-5p	Western blot, Luciferase reporter assay, Northern blot	18755897
MIRT002098	hsa-miR-34a-5p	qRT-PCR, Luciferase reporter assay, Western blot	18834855
MIRT002098	hsa-miR-34a-5p	Review, Luciferase reporter assay	19461653
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	18834855
MIRT002098	hsa-miR-34a-5p	Review	19815577
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20185821
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot	19786632
MIRT005018	hsa-miR-216a-5p	Luciferase reporter assay, Western blot	19786632
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20627091
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20627091
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	19221490
MIRT000333	hsa-miR-132-3p	Luciferase reporter assay, Western blot	19819989
MIRT002098	hsa-miR-34a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	20470934
MIRT002098	hsa-miR-34a-5p	qRT-PCR, Western blot	21297663
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006348	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006349	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT002098	hsa-miR-34a-5p	qRT-PCR, Western blot	21297663
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006348	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006349	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT002098	hsa-miR-34a-5p	qRT-PCR, Western blot	21297663
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006348	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006349	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT006878	hsa-miR-181c-5p	In situ hybridization, Luciferase reporter assay	21720722
MIRT006892	hsa-miR-9-5p	In situ hybridization, Luciferase reporter assay	21720722
MIRT007324	hsa-miR-128-3p	Luciferase reporter assay	23492773
MIRT006892	hsa-miR-9-5p	Western blot;qRT-PCR	20362537
MIRT023069	hsa-miR-124-3p	qRT-PCR	20362537
MIRT024509	hsa-miR-215-5p	Microarray	19074876
MIRT002098	hsa-miR-34a-5p	Reporter assay;Western blot;qRT-PCR	20185821
MIRT002098	hsa-miR-34a-5p	Reporter assay;Western blot;qRT-PCR	20627091
MIRT026849	hsa-miR-192-5p	Microarray	19074876
MIRT052646	hsa-miR-199a-5p	qRT-PCR, Western blot	23760629
MIRT051790	hsa-let-7c-5p	CLASH	23622248
MIRT043458	hsa-miR-331-3p	CLASH	23622248
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	23768087
MIRT053343	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23728341
MIRT053343	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23728341
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	23768087
MIRT052646	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24839982
MIRT002098	hsa-miR-34a-5p	qRT-PCR	23292172
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23954321
MIRT438672	hsa-miR-142-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23752207
MIRT438672	hsa-miR-142-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23752207
MIRT438651	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23877372
MIRT438651	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23877372
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot, qRT-PCR	25172416
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot, qRT-PCR	25172416
MIRT002098	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT002098	hsa-miR-34a-5p	qRT-PCR	23292172
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23954321
MIRT438672	hsa-miR-142-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23752207
MIRT438672	hsa-miR-142-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23752207
MIRT438651	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23877372
MIRT438651	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23877372
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot, qRT-PCR	25172416
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot, qRT-PCR	25172416
MIRT002098	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT177771	hsa-miR-548at-5p	PAR-CLIP	22100165
MIRT450611	hsa-miR-4474-5p	PAR-CLIP	22100165
MIRT439628	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT439628	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT002098	hsa-miR-34a-5p	Western blot	25348795
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	25526086
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	25526086
MIRT002098	hsa-miR-34a-5p	Western blot	25585539
MIRT052646	hsa-miR-199a-5p	Luciferase reporter assay	26344589
MIRT002098	hsa-miR-34a-5p	5.0	26802970
MIRT002098	hsa-miR-34a-5p	5.0	26802970
MIRT006271	hsa-miR-138-5p	In situ hybridization, Luciferase reporter assay, Western blot	28052003
MIRT006271	hsa-miR-138-5p	In situ hybridization, Luciferase reporter assay, Western blot	28052003
MIRT006213	hsa-miR-181a-5p	GFP reporter assay	26922183
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT731643	hsa-miR-133b	Luciferase reporter assay	27166997
MIRT731643	hsa-miR-133b	Luciferase reporter assay	27166997
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay	27156885
MIRT731643	hsa-miR-133b	Luciferase reporter assay	27090017
MIRT731643	hsa-miR-133b	Luciferase reporter assay	27090017
MIRT263012	hsa-miR-543	Luciferase reporter assay, qRT-PCR, Western blot	26612257
MIRT263012	hsa-miR-543	Luciferase reporter assay, qRT-PCR, Western blot	26612257
MIRT052646	hsa-miR-199a-5p	Immunoprecipitaion, qRT-PCR, Western blot	26945677
MIRT006348	hsa-miR-449a	Immunoblot, Luciferase reporter assay, qRT-PCR	26988912
MIRT006348	hsa-miR-449a	Immunoblot, Luciferase reporter assay, qRT-PCR	26988912
MIRT006348	hsa-miR-449a	Luciferase reporter assay, qRT-PCR, Western blot	27421775
MIRT006348	hsa-miR-449a	Luciferase reporter assay, qRT-PCR, Western blot	27421775
MIRT733820	hsa-miR-34a-3p	Western blot	25395581
MIRT733852	hsa-miR-92a-3p	Luciferase reporter assay	25550450
MIRT733852	hsa-miR-92a-3p	Luciferase reporter assay	25550450
MIRT733852	hsa-miR-92a-3p	Luciferase reporter assay	25550450
MIRT733852	hsa-miR-92a-3p	Luciferase reporter assay	25550450
MIRT002098	hsa-miR-34a-5p	Immunoblot, qRT-PCR	28250026
MIRT000333	hsa-miR-132-3p	ChIP-seq, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	28383763
MIRT000333	hsa-miR-132-3p	ChIP-seq, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	28383763
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	28236278
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay, Western blot	28236278
MIRT002098	hsa-miR-34a-5p	Western blot	25826085
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay	27914878
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay	27914878
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay	27914878
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	27767101
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	27767101
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27767101
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27767101
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27767101
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	25998694
MIRT023069	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	27646435
MIRT439628	hsa-miR-155-3p	Luciferase reporter assay, qRT-PCR, Western blot	27646435
MIRT439628	hsa-miR-155-3p	Luciferase reporter assay, qRT-PCR, Western blot	27646435
MIRT439628	hsa-miR-155-3p	Luciferase reporter assay, qRT-PCR, Western blot	27646435
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	27748572
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	27748572
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	27756894
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	27756894
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay	28236278
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	27207584
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	27207584
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	27207584
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27247228
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot	26662303
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blotting, qRT-PCR	32267139
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	31432137
MIRT733631	hsa-miR-1301-3p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	33987098
MIRT733820	hsa-miR-34a-3p	qRT-PCR	33718673
MIRT733852	hsa-miR-92a-3p	qRT-PCR, Western blotting	33742265
MIRT052646	hsa-miR-199a-5p	ELISA, Immunofluorescence, Luciferase reporter assay, qRT-PCR, RNA-seq, Western blotting	34132029
MIRT263019	hsa-miR-22-3p	Western blotting, Microarray, qRT-PCR	31612074
MIRT734467	hsa-miR-155-3p	Immunofluorescence, Luciferase reporter assay, Western blotting	33748285
MIRT002098	hsa-miR-34a-5p	Western blotting, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR, Flow cytometry	32161722
MIRT002098	hsa-miR-34a-5p	qRT-PCR	31885789
MIRT735066	hsa-miR-27a-5p	Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR, Flow cytometry	32790210
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33488795
MIRT000333	hsa-miR-132-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32950974
MIRT735186	hsa-miR-212-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32950974
MIRT000333	hsa-miR-132-3p	Western blotting, qRT-PCR, ELISA	32219698
MIRT735713	hsa-miR-1185-1-3p	Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), in vitro cullelar assays, qRT-PCR, Flow cytometry	33046442
MIRT007324	hsa-miR-128-3p	Western blotting, qRT-PCR	32528236
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31503007
MIRT731643	hsa-miR-133b	qRT-PCR	32655835
MIRT737526	hsa-miR-29a-3p	Microarray, qRT-PCR	32741895
MIRT737527	hsa-miR-23a-3p	Microarray, qRT-PCR	32741895
MIRT177771	hsa-miR-548at-5p	PAR-CLIP	22100165
MIRT450611	hsa-miR-4474-5p	PAR-CLIP	22100165
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	38828289
MIRT756377	hsa-miR-139-5p	Western blotting	37794118
MIRT756394	hsa-miR-141-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34868528
MIRT1350042	hsa-miR-3125	CLIP-seq
MIRT1350043	hsa-miR-3916	CLIP-seq
MIRT1350044	hsa-miR-4266	CLIP-seq
MIRT1350045	hsa-miR-4477a	CLIP-seq
MIRT1350046	hsa-miR-4765	CLIP-seq
MIRT1350047	hsa-miR-4775	CLIP-seq
MIRT1350048	hsa-miR-502-5p	CLIP-seq
MIRT1350049	hsa-miR-651	CLIP-seq
MIRT1350050	hsa-miR-1208	CLIP-seq
MIRT1350051	hsa-miR-1271	CLIP-seq
MIRT1350052	hsa-miR-1279	CLIP-seq
MIRT1350053	hsa-miR-1283	CLIP-seq
MIRT1350054	hsa-miR-1301	CLIP-seq
MIRT1350055	hsa-miR-132	CLIP-seq
MIRT1350056	hsa-miR-182	CLIP-seq
MIRT1350057	hsa-miR-186	CLIP-seq
MIRT1350058	hsa-miR-200b	CLIP-seq
MIRT1350059	hsa-miR-200c	CLIP-seq
MIRT1350060	hsa-miR-212	CLIP-seq
MIRT1350061	hsa-miR-22	CLIP-seq
MIRT1350062	hsa-miR-2355-5p	CLIP-seq
MIRT1350063	hsa-miR-23a	CLIP-seq
MIRT1350064	hsa-miR-23b	CLIP-seq
MIRT1350065	hsa-miR-23c	CLIP-seq
MIRT1350066	hsa-miR-29a	CLIP-seq
MIRT1350067	hsa-miR-29b	CLIP-seq
MIRT1350068	hsa-miR-29c	CLIP-seq
MIRT1350069	hsa-miR-3064-3p	CLIP-seq
MIRT1350070	hsa-miR-3133	CLIP-seq
MIRT1350071	hsa-miR-3140-3p	CLIP-seq
MIRT1350072	hsa-miR-3148	CLIP-seq
MIRT1350073	hsa-miR-3163	CLIP-seq
MIRT1350074	hsa-miR-3177-5p	CLIP-seq
MIRT1350075	hsa-miR-3190	CLIP-seq
MIRT1350076	hsa-miR-338-5p	CLIP-seq
MIRT1350077	hsa-miR-34a	CLIP-seq
MIRT1350078	hsa-miR-34c-5p	CLIP-seq
MIRT1350079	hsa-miR-3591-5p	CLIP-seq
MIRT1350080	hsa-miR-3607-3p	CLIP-seq
MIRT1350081	hsa-miR-3618	CLIP-seq
MIRT1350082	hsa-miR-374c	CLIP-seq
MIRT1350083	hsa-miR-3978	CLIP-seq
MIRT1350084	hsa-miR-412	CLIP-seq
MIRT1350085	hsa-miR-4251	CLIP-seq
MIRT1350086	hsa-miR-4280	CLIP-seq
MIRT1350087	hsa-miR-4286	CLIP-seq
MIRT1350088	hsa-miR-429	CLIP-seq
MIRT1350089	hsa-miR-4328	CLIP-seq
MIRT1350090	hsa-miR-4418	CLIP-seq
MIRT1350091	hsa-miR-4420	CLIP-seq
MIRT1350092	hsa-miR-4455	CLIP-seq
MIRT1350093	hsa-miR-448	CLIP-seq
MIRT1350094	hsa-miR-449b	CLIP-seq
MIRT1350095	hsa-miR-450b-5p	CLIP-seq
MIRT1350096	hsa-miR-4635	CLIP-seq
MIRT1350097	hsa-miR-4660	CLIP-seq
MIRT1350098	hsa-miR-4662a-5p	CLIP-seq
MIRT1350099	hsa-miR-4695-3p	CLIP-seq
MIRT1350100	hsa-miR-4752	CLIP-seq
MIRT1350101	hsa-miR-4773	CLIP-seq
MIRT1350102	hsa-miR-4795-3p	CLIP-seq
MIRT1350103	hsa-miR-488	CLIP-seq
MIRT1350104	hsa-miR-491-3p	CLIP-seq
MIRT1350105	hsa-miR-5047	CLIP-seq
MIRT1350106	hsa-miR-507	CLIP-seq
MIRT1350107	hsa-miR-509-3-5p	CLIP-seq
MIRT1350108	hsa-miR-509-5p	CLIP-seq
MIRT1350109	hsa-miR-526b	CLIP-seq
MIRT1350110	hsa-miR-539	CLIP-seq
MIRT1350111	hsa-miR-548a-5p	CLIP-seq
MIRT1350112	hsa-miR-548ab	CLIP-seq
MIRT1350113	hsa-miR-548ak	CLIP-seq
MIRT1350114	hsa-miR-548b-5p	CLIP-seq
MIRT1350115	hsa-miR-548c-3p	CLIP-seq
MIRT1350116	hsa-miR-548c-5p	CLIP-seq
MIRT1350117	hsa-miR-548d-5p	CLIP-seq
MIRT1350118	hsa-miR-548h	CLIP-seq
MIRT1350119	hsa-miR-548i	CLIP-seq
MIRT1350120	hsa-miR-548j	CLIP-seq
MIRT1350121	hsa-miR-548k	CLIP-seq
MIRT1350122	hsa-miR-548l	CLIP-seq
MIRT1350123	hsa-miR-548n	CLIP-seq
MIRT1350124	hsa-miR-548t	CLIP-seq
MIRT1350125	hsa-miR-548u	CLIP-seq
MIRT1350126	hsa-miR-548w	CLIP-seq
MIRT1350127	hsa-miR-548y	CLIP-seq
MIRT1350128	hsa-miR-557	CLIP-seq
MIRT1350129	hsa-miR-559	CLIP-seq
MIRT1350130	hsa-miR-570	CLIP-seq
MIRT1350131	hsa-miR-586	CLIP-seq
MIRT1350132	hsa-miR-590-3p	CLIP-seq
MIRT1350133	hsa-miR-607	CLIP-seq
MIRT1350134	hsa-miR-609	CLIP-seq
MIRT1350135	hsa-miR-633	CLIP-seq
MIRT1350136	hsa-miR-655	CLIP-seq
MIRT1350137	hsa-miR-936	CLIP-seq
MIRT1350138	hsa-miR-96	CLIP-seq
MIRT1350053	hsa-miR-1283	CLIP-seq
MIRT1350055	hsa-miR-132	CLIP-seq
MIRT2103736	hsa-miR-141	CLIP-seq
MIRT2103737	hsa-miR-200a	CLIP-seq
MIRT1350060	hsa-miR-212	CLIP-seq
MIRT2103738	hsa-miR-3143	CLIP-seq
MIRT2103739	hsa-miR-3149	CLIP-seq
MIRT1350076	hsa-miR-338-5p	CLIP-seq
MIRT1350081	hsa-miR-3618	CLIP-seq
MIRT1350047	hsa-miR-4775	CLIP-seq
MIRT1350133	hsa-miR-607	CLIP-seq
MIRT2327874	hsa-miR-4699-5p	CLIP-seq
MIRT2327875	hsa-miR-4709-3p	CLIP-seq
MIRT2394561	hsa-miR-579	CLIP-seq
MIRT1350057	hsa-miR-186	CLIP-seq
MIRT1350061	hsa-miR-22	CLIP-seq
MIRT2622859	hsa-miR-221	CLIP-seq
MIRT2622860	hsa-miR-222	CLIP-seq
MIRT1350069	hsa-miR-3064-3p	CLIP-seq
MIRT2622861	hsa-miR-3128	CLIP-seq
MIRT1350070	hsa-miR-3133	CLIP-seq
MIRT1350072	hsa-miR-3148	CLIP-seq
MIRT2622862	hsa-miR-3152-3p	CLIP-seq
MIRT2622863	hsa-miR-3187-3p	CLIP-seq
MIRT2622864	hsa-miR-326	CLIP-seq
MIRT2622865	hsa-miR-330-3p	CLIP-seq
MIRT2622866	hsa-miR-330-5p	CLIP-seq
MIRT1350077	hsa-miR-34a	CLIP-seq
MIRT1350078	hsa-miR-34c-5p	CLIP-seq
MIRT1350083	hsa-miR-3978	CLIP-seq
MIRT1350089	hsa-miR-4328	CLIP-seq
MIRT2622867	hsa-miR-4422	CLIP-seq
MIRT1350092	hsa-miR-4455	CLIP-seq
MIRT1350094	hsa-miR-449b	CLIP-seq
MIRT2622868	hsa-miR-4529-5p	CLIP-seq
MIRT2622869	hsa-miR-4666-5p	CLIP-seq
MIRT2622870	hsa-miR-4720-5p	CLIP-seq
MIRT2622871	hsa-miR-4729	CLIP-seq
MIRT2622872	hsa-miR-4768-5p	CLIP-seq
MIRT1350101	hsa-miR-4773	CLIP-seq
MIRT2622873	hsa-miR-4799-3p	CLIP-seq
MIRT1350104	hsa-miR-491-3p	CLIP-seq
MIRT2622874	hsa-miR-494	CLIP-seq
MIRT1350115	hsa-miR-548c-3p	CLIP-seq
MIRT2622875	hsa-miR-548v	CLIP-seq
MIRT2622876	hsa-miR-556-5p	CLIP-seq
MIRT2622877	hsa-miR-562	CLIP-seq
MIRT2394561	hsa-miR-579	CLIP-seq
MIRT1350131	hsa-miR-586	CLIP-seq
MIRT1350134	hsa-miR-609	CLIP-seq
MIRT2622878	hsa-miR-616	CLIP-seq
MIRT1350057	hsa-miR-186	CLIP-seq
MIRT1350061	hsa-miR-22	CLIP-seq
MIRT1350069	hsa-miR-3064-3p	CLIP-seq
MIRT2622861	hsa-miR-3128	CLIP-seq
MIRT1350070	hsa-miR-3133	CLIP-seq
MIRT1350072	hsa-miR-3148	CLIP-seq
MIRT2622862	hsa-miR-3152-3p	CLIP-seq
MIRT2622863	hsa-miR-3187-3p	CLIP-seq
MIRT2622864	hsa-miR-326	CLIP-seq
MIRT2622866	hsa-miR-330-5p	CLIP-seq
MIRT1350077	hsa-miR-34a	CLIP-seq
MIRT1350078	hsa-miR-34c-5p	CLIP-seq
MIRT1350083	hsa-miR-3978	CLIP-seq
MIRT1350089	hsa-miR-4328	CLIP-seq
MIRT1350092	hsa-miR-4455	CLIP-seq
MIRT1350094	hsa-miR-449b	CLIP-seq
MIRT2622868	hsa-miR-4529-5p	CLIP-seq
MIRT2622870	hsa-miR-4720-5p	CLIP-seq
MIRT2622872	hsa-miR-4768-5p	CLIP-seq
MIRT2622873	hsa-miR-4799-3p	CLIP-seq
MIRT1350104	hsa-miR-491-3p	CLIP-seq
MIRT1350115	hsa-miR-548c-3p	CLIP-seq
MIRT2622877	hsa-miR-562	CLIP-seq
MIRT2394561	hsa-miR-579	CLIP-seq
MIRT1350131	hsa-miR-586	CLIP-seq
MIRT1350134	hsa-miR-609	CLIP-seq
MIRT2622878	hsa-miR-616	CLIP-seq

Transcription factors

Show/Hide all(12)

Transcription factor	Regulation	Reference
ATF4	Activation	22363646
ATF4	Repression	21801305
BRCA1	Activation	18851829;20160719;21407215;9000507
CIITA	Repression	22064865
DDIT3	Repression	21801305
FOXL2	Activation	19010791
FOXO3	Activation	23525956
GTF2I	Activation	21407215
HIC1	Repression	19525223;19649206
HIC1	Unknown	22064865
RELA	Activation	20617556
SP1	Unknown	23843607

Show/Hide all(187)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000012	Process	Single strand break repair	IMP	20097625
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12535671, 15692560, 20955178
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	21947282
GO:0000183	Process	RDNA heterochromatin assembly	IDA	18485871
GO:0000183	Process	RDNA heterochromatin assembly	TAS
GO:0000720	Process	Pyrimidine dimer repair by nucleotide-excision repair	IMP	21149730
GO:0000731	Process	DNA synthesis involved in DNA repair	ISS
GO:0000785	Component	Chromatin	IDA	17505061, 22956909
GO:0000791	Component	Euchromatin	IDA	15469825
GO:0000792	Component	Heterochromatin	IDA	15469825
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0001525	Process	Angiogenesis	IDA	20620956
GO:0001542	Process	Ovulation from ovarian follicle	IEA
GO:0001650	Component	Fibrillar center	IDA
GO:0001678	Process	Cellular glucose homeostasis	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	ISS
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	20203304
GO:0002039	Function	P53 binding	IBA	21873635
GO:0002039	Function	P53 binding	IPI	11672523
GO:0002821	Process	Positive regulation of adaptive immune response	IDA	21890893
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003714	Function	Transcription corepressor activity	IBA	21873635
GO:0003714	Function	Transcription corepressor activity	IDA	12535671
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0003950	Function	NAD+ ADP-ribosyltransferase activity	TAS	17456799
GO:0004407	Function	Histone deacetylase activity	EXP	18485871
GO:0004407	Function	Histone deacetylase activity	IDA	20027304
GO:0005515	Function	Protein binding	IPI	11672523, 12006491, 12535671, 14976264, 15126506, 15152190, 15175761, 15205477, 15220471, 15632193, 15692560, 16892051, 16998810, 17172643, 17334224, 17612497, 17680780, 17901049, 17936707, 17964266, 18004385, 18203716, 18235501, 18235502, 18296641, 18485871, 19047049, 19188449, 192
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	11672523, 19934257, 20027304, 20167603, 20955178
GO:0005635	Component	Nuclear envelope	IDA	15469825
GO:0005637	Component	Nuclear inner membrane	IBA	21873635
GO:0005637	Component	Nuclear inner membrane	IDA	15469825
GO:0005654	Component	Nucleoplasm	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA	16079181
GO:0005654	Component	Nucleoplasm	TAS
GO:0005677	Component	Chromatin silencing complex	IDA	18485871
GO:0005730	Component	Nucleolus	IDA	15469825
GO:0005730	Component	Nucleolus	IDA	16079181
GO:0005737	Component	Cytoplasm	IDA	20027304
GO:0005737	Component	Cytoplasm	IDA	15469825
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IMP	22956909
GO:0006346	Process	DNA methylation-dependent heterochromatin assembly	TAS	21947282
GO:0006471	Process	Protein ADP-ribosylation	TAS	17456799
GO:0006476	Process	Protein deacetylation	IDA	18203716, 18662546, 20027304, 20955178, 31722219
GO:0006476	Process	Protein deacetylation	IMP	11672523, 20424141, 24824780
GO:0006476	Process	Protein deacetylation	TAS	28386764
GO:0006642	Process	Triglyceride mobilization	ISS
GO:0006974	Process	Cellular response to DNA damage stimulus	IDA	18203716
GO:0006979	Process	Response to oxidative stress	IDA	14976264
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	23960241
GO:0007283	Process	Spermatogenesis	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IDA	15692560
GO:0007517	Process	Muscle organ development	IEA
GO:0007569	Process	Cell aging	TAS	11672523
GO:0008022	Function	Protein C-terminus binding	IPI	18203716
GO:0008134	Function	Transcription factor binding	IPI	20955178, 23382074
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	21807113
GO:0009267	Process	Cellular response to starvation	ISS
GO:0010629	Process	Negative regulation of gene expression	IMP	17916362, 20203304
GO:0010824	Process	Regulation of centrosome duplication	IDA	31722219
GO:0010875	Process	Positive regulation of cholesterol efflux	ISS
GO:0010883	Process	Regulation of lipid storage	ISS
GO:0010906	Process	Regulation of glucose metabolic process	ISS
GO:0010934	Process	Macrophage cytokine production	ISS
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	ISS
GO:0016032	Process	Viral process	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IDA	18296641
GO:0016567	Process	Protein ubiquitination	IDA	21841822
GO:0016567	Process	Protein ubiquitination	IMP	20203304
GO:0016575	Process	Histone deacetylation	IDA	12006491, 15469825, 16079181, 17172643
GO:0016605	Component	PML body	IDA	12006491
GO:0017136	Function	NAD-dependent histone deacetylase activity	IBA	21873635
GO:0017136	Function	NAD-dependent histone deacetylase activity	IDA	12006491, 15469825, 16959573
GO:0018394	Process	Peptidyl-lysine acetylation	IMP	18004385
GO:0019213	Function	Deacetylase activity	IDA	18203716
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0030225	Process	Macrophage differentiation	ISS
GO:0030308	Process	Negative regulation of cell growth	IMP	17505061
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	ISS
GO:0031393	Process	Negative regulation of prostaglandin biosynthetic process	ISS
GO:0031507	Process	Heterochromatin assembly	IDA	15469825
GO:0031648	Process	Protein destabilization	IDA	20955178
GO:0031648	Process	Protein destabilization	ISS
GO:0032007	Process	Negative regulation of TOR signaling	IMP	20169165
GO:0032071	Process	Regulation of endodeoxyribonuclease activity	IMP	19934257
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	15152190
GO:0032868	Process	Response to insulin	ISS
GO:0032922	Process	Circadian regulation of gene expression	IMP	18662546
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0033210	Process	Leptin-mediated signaling pathway	ISS
GO:0033553	Component	RDNA heterochromatin	IBA	21873635
GO:0033553	Component	RDNA heterochromatin	IDA	18485871
GO:0033558	Function	Protein deacetylase activity	IDA	19934257, 20027304, 21807113, 23056314
GO:0033558	Function	Protein deacetylase activity	IMP	20424141, 20670893
GO:0034391	Process	Regulation of smooth muscle cell apoptotic process	ISS
GO:0034979	Function	NAD-dependent protein deacetylase activity	IDA	20955178, 21775285
GO:0034979	Function	NAD-dependent protein deacetylase activity	IMP	11672523
GO:0034979	Function	NAD-dependent protein deacetylase activity	TAS
GO:0034983	Process	Peptidyl-lysine deacetylation	IDA	15469825
GO:0035098	Component	ESC/E(Z) complex	IDA	15684044
GO:0035257	Function	Nuclear hormone receptor binding	IPI	24043310
GO:0035356	Process	Cellular triglyceride homeostasis	ISS
GO:0035358	Process	Regulation of peroxisome proliferator activated receptor signaling pathway	ISS
GO:0042127	Process	Regulation of cell population proliferation	IMP	12006491
GO:0042326	Process	Negative regulation of phosphorylation	IMP	17612497
GO:0042393	Function	Histone binding	IPI	15469825, 22956909
GO:0042542	Process	Response to hydrogen peroxide	IDA	19934257
GO:0042595	Process	Behavioral response to starvation	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	20100829
GO:0042802	Function	Identical protein binding	IPI	15469825
GO:0042981	Process	Regulation of apoptotic process	IMP	19934257
GO:0043065	Process	Positive regulation of apoptotic process	IDA	15152190
GO:0043065	Process	Positive regulation of apoptotic process	IMP	19047049
GO:0043066	Process	Negative regulation of apoptotic process	IMP	16892051, 21775285
GO:0043124	Process	Negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	17680780
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	21841822
GO:0043280	Process	Positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	19047049
GO:0043398	Function	HLH domain binding	IPI	12535671
GO:0043425	Function	BHLH transcription factor binding	IPI	12535671, 21807113
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	11672523, 20955178
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IMP	17505061
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	11672523
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	23960241
GO:0044321	Process	Response to leptin	ISS
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IDA	21890893
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045722	Process	Positive regulation of gluconeogenesis	IDA	30193097
GO:0045739	Process	Positive regulation of DNA repair	IMP	19934257
GO:0045766	Process	Positive regulation of angiogenesis	IDA	23960241, 25217442
GO:0045766	Process	Positive regulation of angiogenesis	IMP	20424141, 24048733
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IBA	21873635
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	11672523, 20074560
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12837246, 21807113
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IDA	21241768
GO:0046872	Function	Metal ion binding	IEA
GO:0046969	Function	NAD-dependent histone deacetylase activity (H3-K9 specific)	ISS
GO:0050872	Process	White fat cell differentiation	ISS
GO:0051019	Function	Mitogen-activated protein kinase binding	IPI	20027304
GO:0051097	Process	Negative regulation of helicase activity	IDA	18203716
GO:0051152	Process	Positive regulation of smooth muscle cell differentiation	IEA
GO:0051574	Process	Positive regulation of histone H3-K9 methylation	IMP	22956909
GO:0051898	Process	Negative regulation of protein kinase B signaling	IMP	21149730
GO:0055089	Process	Fatty acid homeostasis	ISS
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IMP	17505061
GO:0061647	Process	Histone H3-K9 modification	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	20027304
GO:0070403	Function	NAD+ binding	IBA	21873635
GO:0070829	Process	Heterochromatin maintenance	IMP	15469825
GO:0070857	Process	Regulation of bile acid biosynthetic process	ISS
GO:0070914	Process	UV-damage excision repair	IMP	20670893
GO:0070932	Process	Histone H3 deacetylation	IBA	21873635
GO:0070932	Process	Histone H3 deacetylation	IDA	20027304
GO:0070932	Process	Histone H3 deacetylation	IMP	17505061
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	15152190
GO:0071441	Process	Negative regulation of histone H3-K14 acetylation	IMP	17916362
GO:0071456	Process	Cellular response to hypoxia	IMP	20620956
GO:0071479	Process	Cellular response to ionizing radiation	ISS
GO:0071900	Process	Regulation of protein serine/threonine kinase activity	IMP	20203304
GO:0090335	Process	Regulation of brown fat cell differentiation	ISS
GO:0090400	Process	Stress-induced premature senescence	IMP	17916362
GO:0106230	Process	Protein depropionylation	ISS
GO:0106231	Function	Protein-propionyllysine depropionylase activity	ISS
GO:1900034	Process	Regulation of cellular response to heat	TAS
GO:1900113	Process	Negative regulation of histone H3-K9 trimethylation	IEA
GO:1901215	Process	Negative regulation of neuron death	IEA
GO:1901984	Process	Negative regulation of protein acetylation	IMP	17916362, 20203304
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	ISS	11672522
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IMP	17317627
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1904179	Process	Positive regulation of adipose tissue development	ISS
GO:1990254	Function	Keratin filament binding	IPI	23382074
GO:1990619	Process	Histone H3-K9 deacetylation	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:2000111	Process	Positive regulation of macrophage apoptotic process	ISS
GO:2000480	Process	Negative regulation of cAMP-dependent protein kinase activity	IDA	20203304
GO:2000481	Process	Positive regulation of cAMP-dependent protein kinase activity	IMP	18687677
GO:2000619	Process	Negative regulation of histone H4-K16 acetylation	IMP	17916362
GO:2000655	Process	Negative regulation of cellular response to testosterone stimulus	IMP	17505061
GO:2000757	Process	Negative regulation of peptidyl-lysine acetylation	IDA	20100829
GO:2000773	Process	Negative regulation of cellular senescence	IDA	20203304
GO:2000773	Process	Negative regulation of cellular senescence	IMP	20424141
GO:2000774	Process	Positive regulation of cellular senescence	IDA	18687677

MIM	HGNC	e!Ensembl
604479	14929	ENSG00000096717

Protein

UniProt ID

Q96EB6

Protein name

NAD-dependent protein deacetylase sirtuin-1 (hSIRT1) (EC 2.3.1.286) (NAD-dependent protein deacylase sirtuin-1) (EC 2.3.1.-) (Regulatory protein SIR2 homolog 1) (SIR2-like protein 1) (hSIR2) [Cleaved into: SirtT1 75 kDa fragment (75SirT1)]

Protein function

NAD-dependent protein deacetylase that links transcriptional regulation directly to intracellular energetics and participates in the coordination of several separated cellular functions such as cell cycle, response to DNA damage, metabolism, apo

PDB

4I5I , 4IF6 , 4IG9 , 4KXQ , 4ZZH , 4ZZI , 4ZZJ , 5BTR , 8ANB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02146	SIR2	261 → 447	Sir2 family	Family

Sequence

MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREV
PAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNL
YDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP
RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDI
NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII
QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE
QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLG
DCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSS
PERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDL
KNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSD
SEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTD
GDDQEAINEAISVKQEVTDMNYPSNKS

Sequence length

747

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412