SEM1 (SEM1 26S proteasome subunit)

Gene

• Entrez ID: 7979
• Gene name: SEM1 26S proteasome subunit
• Gene symbol: SEM1
• Synonyms: C7orf76, DSS1, ECD, PSMD15, SHFD1, SHFM1, SHSF1, Shfdg1
• Chromosome: 7
• Chromosome location: 7q21.3
• Summary: The product of this gene has been localized within the split hand/split foot malformation locus SHFM1 at chromosome 7. It has been proposed to be a candidate gene for the autosomal dominant form of the heterogeneous limb developmental disorder split hand/split foot malformation type 1. In addition, it has been shown to directly interact with BRCA2. It also may play a role in the completion of the cell cycle. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029635	hsa-miR-26b-5p	Microarray	19088304
MIRT047956	hsa-miR-30c-5p	CLASH	23622248
MIRT450536	hsa-miR-599	PAR-CLIP	22100165
MIRT450537	hsa-miR-653-5p	PAR-CLIP	22100165
MIRT450538	hsa-miR-3161	PAR-CLIP	22100165
MIRT450539	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT450540	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT450541	hsa-miR-1233-3p	PAR-CLIP	22100165
MIRT450542	hsa-miR-1225-3p	PAR-CLIP	22100165
MIRT450543	hsa-miR-5590-3p	PAR-CLIP	22100165
MIRT450544	hsa-miR-142-5p	PAR-CLIP	22100165
MIRT450545	hsa-miR-8054	PAR-CLIP	22100165
MIRT450546	hsa-miR-548l	PAR-CLIP	22100165
MIRT450547	hsa-miR-548k	PAR-CLIP	22100165
MIRT450548	hsa-miR-548av-5p	PAR-CLIP	22100165
MIRT450549	hsa-miR-559	PAR-CLIP	22100165
MIRT450550	hsa-miR-548y	PAR-CLIP	22100165
MIRT450551	hsa-miR-548w	PAR-CLIP	22100165
MIRT450552	hsa-miR-548o-5p	PAR-CLIP	22100165
MIRT450553	hsa-miR-548j-5p	PAR-CLIP	22100165
MIRT450554	hsa-miR-548i	PAR-CLIP	22100165
MIRT450555	hsa-miR-548h-5p	PAR-CLIP	22100165
MIRT450556	hsa-miR-548d-5p	PAR-CLIP	22100165
MIRT450557	hsa-miR-548c-5p	PAR-CLIP	22100165
MIRT450558	hsa-miR-548bb-5p	PAR-CLIP	22100165
MIRT450559	hsa-miR-548b-5p	PAR-CLIP	22100165
MIRT450560	hsa-miR-548ay-5p	PAR-CLIP	22100165
MIRT450561	hsa-miR-548au-5p	PAR-CLIP	22100165
MIRT450562	hsa-miR-548as-5p	PAR-CLIP	22100165
MIRT450563	hsa-miR-548ar-5p	PAR-CLIP	22100165
MIRT450564	hsa-miR-548aq-5p	PAR-CLIP	22100165
MIRT450565	hsa-miR-548ap-5p	PAR-CLIP	22100165
MIRT450566	hsa-miR-548am-5p	PAR-CLIP	22100165
MIRT450567	hsa-miR-548ak	PAR-CLIP	22100165
MIRT450568	hsa-miR-548ae-5p	PAR-CLIP	22100165
MIRT450569	hsa-miR-548ad-5p	PAR-CLIP	22100165
MIRT450570	hsa-miR-548ab	PAR-CLIP	22100165
MIRT450571	hsa-miR-548a-5p	PAR-CLIP	22100165

Other IDs

• MIM: 601285
• HGNC: 10845
• e!Ensembl: ENSG00000127922

Protein

• UniProt ID: P60896
• Protein name: 26S proteasome complex subunit SEM1 (26S proteasome complex subunit DSS1) (Deleted in split hand/split foot protein 1) (Split hand/foot deleted protein 1) (Split hand/foot malformation type 1 protein)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair (PubMed:15117943). Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, SEM1, and either centrin CETN2 or CETN3 (PubMed:22307388). The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery. Binds and stabilizes BRCA2 and is thus involved in the control of R-loop-associated DNA damage and thus transcription-associated genomic instability. R-loop accumulation increases in SEM1-depleted cells.
• PDB: 1IYJ, 1MIU, 1MJE, 3T5X, 5GJQ, 5GJR, 5L4K, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFR, 5VFT, 5VGZ, 5VHF, 5VHH, 5VHI, 5VHS, 6MSB, 6MSD, 6MSG, 6MSH, 6MSJ, 6MSK, 6WJD, 6WJN
• UniProt ID: Q6ZVN7
• Protein name: Putative protein SEM1, isoform 2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17697	DUF5543	1 → 128		Family

• Sequence:

  MYCQDSNICAVFAVQGGKVGRKHGIKRGRRPSIRSPAQRARGPWIHESKHPAFAKQQINL
  EMPNSRATTELAWVCSSTSRKKKWARSLTLSTAPLSPPPSLVHCEDCSCLPGCHSGDLYN
  LAPAERTC

• Sequence length: 128