SELE (selectin E)

Gene

• Entrez ID: 6401
• Gene name: Selectin E
• Gene symbol: SELE
• Synonyms: CD62E, ELAM, ELAM1, ESEL, LECAM2
• Chromosome: 1
• Chromosome location: 1q24.2
• Summary: The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004019	hsa-miR-31-5p	Immunocytochemistry, Northern blot, qRT-PCR, Western blot	19949084
MIRT005711	hsa-miR-17-5p	Luciferase reporter assay	19949084
MIRT005712	hsa-miR-17-3p	Luciferase reporter assay	19949084
MIRT005713	hsa-miR-155-5p	Luciferase reporter assay	19949084
MIRT005714	hsa-miR-221-3p	Luciferase reporter assay	19949084
MIRT005715	hsa-miR-222-3p	Luciferase reporter assay	19949084
MIRT005716	hsa-miR-1256	Luciferase reporter assay	19949084
MIRT722471	hsa-miR-4652-3p	HITS-CLIP	19536157
MIRT722472	hsa-miR-4743-3p	HITS-CLIP	19536157
MIRT722473	hsa-miR-3686	HITS-CLIP	19536157
MIRT722474	hsa-miR-630	HITS-CLIP	19536157
MIRT722475	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT722476	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT722477	hsa-miR-3065-5p	HITS-CLIP	19536157

Transcription factors

Transcription factor	Regulation	Reference
ATF3	Repression	10964678
HOXA9	Unknown	22269951
NFKB1	Activation	10946302;12408953;12885753;19422386
NFKB1	Unknown	8878392
REL	Activation	12408953
RELA	Activation	10946302;12885753;19422386
RELA	Unknown	11827962;23042817;8878392
SIRT1	Unknown	21810449
STAT6	Repression	9092569

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002092	Process	Positive regulation of receptor internalization	IDA	9312078
GO:0002523	Process	Leukocyte migration involved in inflammatory response	TAS	18029551
GO:0004888	Function	Transmembrane signaling receptor activity	IMP	12960351
GO:0005515	Function	Protein binding	IPI	18606703, 32814053
GO:0005615	Component	Extracellular space	IDA	9290466
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IDA	28011641
GO:0005901	Component	Caveola	IDA	12960351
GO:0005905	Component	Clathrin-coated pit	IDA	18029551
GO:0006954	Process	Inflammatory response	TAS	2466335
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	18029551
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	7680663
GO:0007202	Process	Activation of phospholipase C activity	IMP	12960351
GO:0019722	Process	Calcium-mediated signaling	TAS	12960351
GO:0030029	Process	Actin filament-based process	IDA	8609175
GO:0030863	Component	Cortical cytoskeleton	IDA	8609175
GO:0032496	Process	Response to lipopolysaccharide	TAS	18029551
GO:0033691	Function	Sialic acid binding	IDA	7680663
GO:0034612	Process	Response to tumor necrosis factor	TAS	18029551
GO:0043274	Function	Phospholipase binding	IDA	12960351
GO:0045121	Component	Membrane raft	IDA	18029551
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12960351
GO:0050727	Process	Regulation of inflammatory response	TAS	18029551
GO:0050900	Process	Leukocyte migration	TAS
GO:0050901	Process	Leukocyte tethering or rolling	IMP	18029551
GO:0070492	Function	Oligosaccharide binding	IDA	7680663
GO:0070555	Process	Response to interleukin-1	IDA	8609175
GO:1903238	Process	Positive regulation of leukocyte tethering or rolling	ISS

Other IDs

• MIM: 131210
• HGNC: 10718
• e!Ensembl: ENSG00000007908

Protein

• UniProt ID: P16581
• Protein name: E-selectin (CD62 antigen-like family member E) (Endothelial leukocyte adhesion molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD antigen CD62E)
• Protein function: Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with SELPLG/PSGL1. May have a role in capillary morphogenesis.
• PDB: 1ESL, 1G1T, 1KJA, 4C16, 4CSY, 6EYI, 6EYJ, 6EYK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	29 → 140	Lectin C-type domain	Domain
  PF00008	EGF	143 → 173	EGF-like domain	Domain
  PF00084	Sushi	180 → 237	Sushi repeat (SCR repeat)	Domain
  PF00084	Sushi	242 → 299	Sushi repeat (SCR repeat)	Domain
  PF00084	Sushi	304 → 362	Sushi repeat (SCR repeat)	Domain
  PF00084	Sushi	367 → 425	Sushi repeat (SCR repeat)	Domain
  PF00084	Sushi	430 → 488	Sushi repeat (SCR repeat)	Domain
  PF00084	Sushi	493 → 547	Sushi repeat (SCR repeat)	Domain

• Sequence:

  MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
  SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
  DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
  TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV
  ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
  AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
  VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
  EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
  WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW
  SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD
  GSYQKPSYIL

• Sequence length: 610