SEL1L (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase)

Gene

• Entrez ID: 6400
• Gene name: SEL1L adaptor subunit of ERAD E3 ubiquitin ligase
• Gene symbol: SEL1L
• Synonyms: Hrd3, PRO1063, SEL1-LIKE, SEL1L1
• Chromosome: 14
• Chromosome location: 14q31.1
• Summary: The protein encoded by this gene is part of a protein complex required for the retrotranslocation or dislocation of misfolded proteins from the endoplasmic reticulum lumen to the cytosol, where they are degraded by the proteasome in a ubiquitin-dependent manner. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005008	hsa-miR-125b-5p	Microarray	17891175
MIRT018739	hsa-miR-335-5p	Microarray	18185580
MIRT054478	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	23661430
MIRT529743	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT529745	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT529746	hsa-miR-548z	PAR-CLIP	22012620
MIRT529747	hsa-miR-548h-3p	PAR-CLIP	22012620
MIRT529748	hsa-miR-548d-3p	PAR-CLIP	22012620
MIRT529749	hsa-miR-548bb-3p	PAR-CLIP	22012620
MIRT529750	hsa-miR-548ac	PAR-CLIP	22012620
MIRT726637	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT726638	hsa-miR-19a-3p	HITS-CLIP	22473208

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000836	Component	Hrd1p ubiquitin ligase complex	TAS	21454652, 23710284
GO:0000839	Component	Hrd1p ubiquitin ligase ERAD-L complex	IBA	21873635
GO:0000839	Component	Hrd1p ubiquitin ligase ERAD-L complex	IMP	26471130
GO:0004842	Function	Ubiquitin-protein transferase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	18264092, 18502753, 18711132, 19135427, 19524542, 19706418, 22119785, 26471130, 26551274, 28514442, 28827405, 31477895
GO:0005783	Component	Endoplasmic reticulum	IDA	26471130
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006641	Process	Triglyceride metabolic process	ISS
GO:0007219	Process	Notch signaling pathway	IEA
GO:0009306	Process	Protein secretion	ISS
GO:0016021	Component	Integral component of membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	IBA	21873635
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	TAS	22013210
GO:0030970	Process	Retrograde protein transport, ER to cytosol	IMP	25660456
GO:0036503	Process	ERAD pathway	IMP	21454652, 26471130
GO:0036503	Process	ERAD pathway	ISS
GO:0036513	Component	Derlin-1 retrotranslocation complex	IDA	21454652
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IEA
GO:0050821	Process	Protein stabilization	TAS	23710284
GO:0055085	Process	Transmembrane transport	TAS
GO:1904380	Process	Endoplasmic reticulum mannose trimming	TAS

Other IDs

• MIM: 602329
• HGNC: 10717
• e!Ensembl: ENSG00000071537

Protein

• UniProt ID: Q9UBV2
• Protein name: Protein sel-1 homolog 1 (Suppressor of lin-12-like protein 1) (Sel-1L)
• Protein function: Plays a role in the endoplasmic reticulum quality control (ERQC) system also called ER-associated degradation (ERAD) involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins (PubMed:16186509). Enhances SYVN1 stability. Plays a role in LPL maturation and secretion. Required for normal differentiation of the pancreas epithelium, and for normal exocrine function and survival of pancreatic cells. May play a role in Notch signaling.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00040	fn2	127 → 168	Fibronectin type II domain	Domain
  PF08238	Sel1	183 → 218	Sel1 repeat	Repeat
  PF08238	Sel1	219 → 254	Sel1 repeat	Repeat
  PF08238	Sel1	373 → 409	Sel1 repeat	Repeat
  PF08238	Sel1	410 → 446	Sel1 repeat	Repeat
  PF08238	Sel1	447 → 482	Sel1 repeat	Repeat
  PF08238	Sel1	483 → 518	Sel1 repeat	Repeat
  PF08238	Sel1	627 → 662	Sel1 repeat	Repeat
  PF08238	Sel1	664 → 698	Sel1 repeat	Repeat

• Sequence:

  MRVRIGLTLLLCAVLLSLASASSDEEGSQDESLDSKTTLTSDESVKDHTTAGRVVAGQIF
  LDSEESELESSIQEEEDSLKSQEGESVTEDISFLESPNPENKDYEEPKKVRKPALTAIEG
  TAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQM
  QEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDYLPQNIQ
  AAREMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYR
  YWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDL
  IQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMY
  SEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQ
  GWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCH
  TAVELFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILDQR
  EASIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQ
  QHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFLQY
  IRETNIRDMFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPAPRPPGPRPA
  PPQQEGPPEQQPPQ

• Sequence length: 794