SDC4 (syndecan 4)

Gene

• Entrez ID: 6385
• Gene name: Syndecan 4
• Gene symbol: SDC4
• Synonyms: SYND4
• Chromosome: 20
• Chromosome location: 20q13.12
• Summary: The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene is found on chromosome 20, while a pseudogene has been found on chromosome 22. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002795	hsa-miR-1-3p	Microarray	15685193
MIRT002795	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT022356	hsa-miR-124-3p	Microarray	18668037
MIRT438457	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR	25089138
MIRT468710	hsa-miR-31-5p	PAR-CLIP	23592263
MIRT468710	hsa-miR-31-5p	PAR-CLIP	26701625
MIRT468711	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT468711	hsa-miR-873-5p	PAR-CLIP	26701625
MIRT468712	hsa-miR-548an	PAR-CLIP	23592263
MIRT468712	hsa-miR-548an	PAR-CLIP	26701625
MIRT468713	hsa-miR-548as-3p	PAR-CLIP	23592263
MIRT468713	hsa-miR-548as-3p	PAR-CLIP	26701625
MIRT468714	hsa-miR-548z	PAR-CLIP	23592263
MIRT468714	hsa-miR-548z	PAR-CLIP	26701625
MIRT468715	hsa-miR-548h-3p	PAR-CLIP	23592263
MIRT468715	hsa-miR-548h-3p	PAR-CLIP	26701625
MIRT468716	hsa-miR-548d-3p	PAR-CLIP	23592263
MIRT468716	hsa-miR-548d-3p	PAR-CLIP	26701625
MIRT468717	hsa-miR-548bb-3p	PAR-CLIP	23592263
MIRT468717	hsa-miR-548bb-3p	PAR-CLIP	26701625
MIRT468718	hsa-miR-548ac	PAR-CLIP	23592263
MIRT468718	hsa-miR-548ac	PAR-CLIP	26701625
MIRT468719	hsa-miR-488-3p	PAR-CLIP	23592263
MIRT468720	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT468721	hsa-miR-7974	PAR-CLIP	23592263
MIRT468722	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT468723	hsa-miR-3202	PAR-CLIP	23592263
MIRT468724	hsa-miR-4252	PAR-CLIP	23592263
MIRT468725	hsa-miR-7515	PAR-CLIP	23592263
MIRT468726	hsa-miR-4493	PAR-CLIP	23592263
MIRT468727	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT468728	hsa-miR-5681a	PAR-CLIP	23592263
MIRT468729	hsa-miR-8073	PAR-CLIP	23592263
MIRT468730	hsa-miR-6868-5p	PAR-CLIP	23592263
MIRT468731	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT468732	hsa-miR-221-5p	PAR-CLIP	23592263
MIRT468733	hsa-miR-4739	PAR-CLIP	23592263
MIRT468734	hsa-miR-1321	PAR-CLIP	23592263
MIRT468735	hsa-miR-4717-5p	PAR-CLIP	23592263
MIRT468736	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT468737	hsa-miR-4476	PAR-CLIP	23592263
MIRT468738	hsa-miR-4753-5p	PAR-CLIP	23592263
MIRT745423	hsa-miR-449b-3p	PAR-CLIP	26701625
MIRT747094	hsa-miR-4691-3p	PAR-CLIP	26701625
MIRT747971	hsa-miR-4733-3p	PAR-CLIP	26701625
MIRT749474	hsa-miR-500b-3p	PAR-CLIP	26701625

Transcription factors

Transcription factor	Regulation	Reference
POU2F1	Unknown	19212692

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	TAS
GO:0001657	Process	Ureteric bud development	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0001968	Function	Fibronectin binding	IEA
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005515	Function	Protein binding	IPI	12571249, 18093920, 19350579, 25416956, 32296183
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	NAS	1500433
GO:0005925	Component	Focal adhesion	IEA
GO:0006024	Process	Glycosaminoglycan biosynthetic process	TAS
GO:0006027	Process	Glycosaminoglycan catabolic process	TAS
GO:0009986	Component	Cell surface	IBA	21873635
GO:0010762	Process	Regulation of fibroblast migration	IEA
GO:0016477	Process	Cell migration	IBA	21873635
GO:0042060	Process	Wound healing	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IMP	19350579
GO:0042802	Function	Identical protein binding	IPI	18093920
GO:0043034	Component	Costamere	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045121	Component	Membrane raft	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IEA
GO:0050900	Process	Leukocyte migration	TAS
GO:0051496	Process	Positive regulation of stress fiber assembly	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IEA
GO:0060122	Process	Inner ear receptor cell stereocilium organization	IEA
GO:0070053	Function	Thrombospondin receptor activity	IMP	17879962
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:1903543	Process	Positive regulation of exosomal secretion	IMP	22660413
GO:1903553	Process	Positive regulation of extracellular exosome assembly	IMP	22660413

Other IDs

• MIM: 600017
• HGNC: 10661
• e!Ensembl: ENSG00000124145

Protein

• UniProt ID: P31431
• Protein name: Syndecan-4 (SYND4) (Amphiglycan) (Ryudocan core protein)
• Protein function: Cell surface proteoglycan that bears heparan sulfate. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP (PubMed:22660413).
• PDB: 1EJP, 1EJQ, 1OBY, 1YBO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01034	Syndecan	139 → 196	Syndecan domain	Family

• Sequence:

  MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFEL
  SGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVE
  ESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSY
  DLGKKPIYKKAPTNEFYA

• Sequence length: 198