SDC2 (syndecan 2)

Gene

• Entrez ID: 6383
• Gene name: Syndecan 2
• Gene symbol: SDC2
• Synonyms: CD362, HSPG, HSPG1, SYND2
• Chromosome: 8
• Chromosome location: 8q22.1
• Summary: The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT468739	hsa-miR-3202	PAR-CLIP	23592263
MIRT468740	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT468741	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT468742	hsa-miR-4784	PAR-CLIP	23592263
MIRT468743	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT468744	hsa-miR-3179	PAR-CLIP	23592263
MIRT468745	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT468746	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT468747	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT468748	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT468749	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT468750	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT468751	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT468752	hsa-miR-4476	PAR-CLIP	23592263
MIRT468753	hsa-miR-577	PAR-CLIP	23592263
MIRT468754	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT468755	hsa-miR-3916	PAR-CLIP	23592263
MIRT468756	hsa-miR-3125	PAR-CLIP	23592263
MIRT468757	hsa-miR-7-2-3p	PAR-CLIP	23592263
MIRT468758	hsa-miR-7-1-3p	PAR-CLIP	23592263
MIRT468759	hsa-miR-5688	PAR-CLIP	23592263
MIRT468760	hsa-miR-495-3p	PAR-CLIP	23592263

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	TAS
GO:0005515	Function	Protein binding	IPI	9660868, 11356864, 18093920, 22660413, 32296183, 32814053
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006024	Process	Glycosaminoglycan biosynthetic process	TAS
GO:0006027	Process	Glycosaminoglycan catabolic process	TAS
GO:0008150	Process	Biological_process	ND
GO:0009986	Component	Cell surface	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA
GO:0016477	Process	Cell migration	IBA	21873635
GO:0030165	Function	PDZ domain binding	IPI	18256285
GO:0042802	Function	Identical protein binding	IPI	18093920, 21988832
GO:0043202	Component	Lysosomal lumen	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048813	Process	Dendrite morphogenesis	IBA	21873635
GO:0048814	Process	Regulation of dendrite morphogenesis	ISS
GO:0050900	Process	Leukocyte migration	TAS
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	27068509

Other IDs

• MIM: 142460
• HGNC: 10659
• e!Ensembl: ENSG00000169439

Protein

• UniProt ID: P34741
• Protein name: Syndecan-2 (SYND2) (Fibroglycan) (Heparan sulfate proteoglycan core protein) (HSPG) (CD antigen CD362)
• Protein function: Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis (By similarity).
• PDB: 6ITH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01034	Syndecan	138 → 199	Syndecan domain	Family

• Sequence:

  MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGAD
  EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERK
  MDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYD
  LGERKPSSAAYQKAPTKEFYA

• Sequence length: 201