SDC1 (syndecan 1)

Gene

• Entrez ID: 6382
• Gene name: Syndecan 1
• Gene symbol: SDC1
• Synonyms: CD138, SDC, SYND1, syndecan
• Chromosome: 2
• Chromosome location: 2p24.1
• Summary: The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-1 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-1 expression has been detected in several different tumor types. While several transcript variants may exist for this gene, the full-length natures of only two have been described to date. These two represent the major variants of this gene and encode the same protein. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007072	hsa-miR-10b-5p	Luciferase reporter assay	22573479
MIRT007072	hsa-miR-10b-5p	3'LIFE	25074381
MIRT007072	hsa-miR-10b-5p	Luciferase reporter assay	23206733
MIRT019998	hsa-miR-375	Microarray	20215506
MIRT021459	hsa-miR-9-5p	Microarray	17612493
MIRT045538	hsa-miR-149-5p	CLASH	23622248
MIRT052912	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	24722758
MIRT053346	hsa-miR-494-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	23728345
MIRT442572	hsa-miR-4480	PAR-CLIP	22100165
MIRT442573	hsa-miR-4756-3p	PAR-CLIP	22100165
MIRT442574	hsa-miR-5582-5p	PAR-CLIP	22100165
MIRT614584	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT614585	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT614586	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT614587	hsa-miR-1264	HITS-CLIP	23824327
MIRT616061	hsa-miR-6732-3p	HITS-CLIP	23824327
MIRT616062	hsa-miR-652-5p	HITS-CLIP	23824327
MIRT734777	hsa-miR-302a-3p	Luciferase reporter assay	26191180

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	16132527
RELA	Activation	16132527

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	TAS
GO:0001657	Process	Ureteric bud development	IEA
GO:0005515	Function	Protein binding	IPI	15292202, 18093920, 23395182, 32814053
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	2324102
GO:0006024	Process	Glycosaminoglycan biosynthetic process	TAS
GO:0006027	Process	Glycosaminoglycan catabolic process	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0008022	Function	Protein C-terminus binding	IPI	16982797
GO:0009636	Process	Response to toxic substance	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA	21873635
GO:0009986	Component	Cell surface	IDA	25063885
GO:0016477	Process	Cell migration	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0032991	Component	Protein-containing complex	IEA
GO:0042060	Process	Wound healing	IEA
GO:0042476	Process	Odontogenesis	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042802	Function	Identical protein binding	IPI	18093920
GO:0043202	Component	Lysosomal lumen	TAS
GO:0048627	Process	Myoblast development	ISS
GO:0050900	Process	Leukocyte migration	TAS
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0051592	Process	Response to calcium ion	IEA
GO:0055002	Process	Striated muscle cell development	IEP	9566955
GO:0060009	Process	Sertoli cell development	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1903543	Process	Positive regulation of exosomal secretion	IMP	22660413
GO:1903553	Process	Positive regulation of extracellular exosome assembly	IMP	22660413

Other IDs

• MIM: 186355
• HGNC: 10658
• e!Ensembl: ENSG00000115884

Protein

• UniProt ID: P18827
• Protein name: Syndecan-1 (SYND1) (CD antigen CD138)
• Protein function: Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP (PubMed:22660413).
• PDB: 4GVC, 4GVD, 6EJE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01034	Syndecan	245 → 308	Syndecan domain	Family

• Sequence:

  MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQ
  TPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQE
  ATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHT
  EDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGAT
  GASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ
  KPTKQEEFYA

• Sequence length: 310