GediPNet logo

SCN1B (sodium voltage-gated channel beta subunit 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6324
Gene nameGene Name - the full gene name approved by the HGNC.
Sodium voltage-gated channel beta subunit 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
SCN1B
SynonymsGene synonyms aliases
ATFB13, BRGDA5, DEE52, EIEE52, GEFSP1
ChromosomeChromosome number
19
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.11
SummarySummary of gene provided in NCBI Entrez Gene.
Voltage-gated sodium channels are heteromeric proteins that function in the generation and propagation of action potentials in muscle and neuronal cells. They are composed of one alpha and two beta subunits, where the alpha subunit provides channel activi
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs16969925 G>A Pathogenic Coding sequence variant, missense variant
rs66876876 G>A Benign-likely-benign, conflicting-interpretations-of-pathogenicity, uncertain-significance Intron variant, coding sequence variant, missense variant
rs72552027 G>A Likely-benign, conflicting-interpretations-of-pathogenicity, benign-likely-benign Coding sequence variant, genic upstream transcript variant, missense variant, upstream transcript variant
rs72558026 G>A Benign, conflicting-interpretations-of-pathogenicity, uncertain-significance Intron variant, coding sequence variant, missense variant
rs72558028 G>A,C Likely-benign, benign, benign-likely-benign, conflicting-interpretations-of-pathogenicity, uncertain-significance Intron variant, coding sequence variant, missense variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016821 hsa-miR-335-5p Microarray 18185580
MIRT047007 hsa-miR-210-3p CLASH 23622248
MIRT038411 hsa-miR-296-3p CLASH 23622248
MIRT531887 hsa-miR-136-3p PAR-CLIP 22012620
MIRT531886 hsa-miR-6785-3p PAR-CLIP 22012620
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001518 Component Voltage-gated sodium channel complex IBA 21873635
GO:0001518 Component Voltage-gated sodium channel complex IDA 8125980, 19808477, 21051419, 30190309
GO:0005244 Function Voltage-gated ion channel activity IEA
GO:0005248 Function Voltage-gated sodium channel activity IDA 19808477
GO:0005515 Function Protein binding IPI 26900580, 30190309
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q07699
Protein name Sodium channel regulatory subunit beta-1
Protein function Regulatory subunit of multiple voltage-gated sodium (Nav) channels directly mediating the depolarization of excitable membranes. Navs, also called VGSCs (voltage-gated sodium channels) or VDSCs (voltage-dependent sodium channels), operate by swi
PDB 6AGF , 6J8G , 6J8H , 6J8I , 6J8J , 7W77 , 7W7F , 7W9K , 7W9L , 7W9M , 7W9P , 7W9T , 7XM9 , 7XMF , 7XMG , 7XVE , 7XVF , 8FHD , 8G1A , 8GZ1 , 8GZ2 , 8I5B , 8I5G , 8I5X , 8I5Y , 8J4F , 8S9B , 8S9C , 8THG , 8THH , 8XMM , 8XMN , 8XMO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set
23 146
Immunoglobulin V-set domain
Domain
Sequence
MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFR
QKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYE
CHVYRLLFFENYEHNTSVVKKIHIEV
VDKANRDMASIVSEIMMYVLIVVLTIWLVAEMIY
CYKKIAAATETAAQENASEYLAITSESKENCTGVQVAE
Sequence length 218
Interactions View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412