RXRG (retinoid X receptor gamma)

Gene

• Entrez ID: 6258
• Gene name: Retinoid X receptor gamma
• Gene symbol: RXRG
• Synonyms: NR2B3, RXRC
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jun 2010]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003707	Function	Steroid hormone receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	16189514, 20133701, 21516116, 21900206, 21988832, 25303530, 25416956, 25910212, 28514442, 29892012, 31515488, 32296183, 32814053
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0008270	Function	Zinc ion binding	IEA
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0032526	Process	Response to retinoic acid	IBA	21873635
GO:0043401	Process	Steroid hormone mediated signaling pathway	IEA
GO:0044323	Function	Retinoic acid-responsive element binding	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0048384	Process	Retinoic acid receptor signaling pathway	IBA	21873635
GO:0048856	Process	Anatomical structure development	IBA	21873635
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA	21873635
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 180247
• HGNC: 10479
• e!Ensembl: ENSG00000143171

Protein

• UniProt ID: P48443
• Protein name: Retinoic acid receptor RXR-gamma (Nuclear receptor subfamily 2 group B member 3) (Retinoid X receptor gamma)
• Protein function: Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. The high affinity ligand for RXRs is 9-cis retinoic acid (By similarity).
• PDB: 2GL8, 7A79
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11825	Nuc_recep-AF1	25 → 134	Nuclear/hormone receptor activator site AF-1	Family
  PF00105	zf-C4	137 → 206	Zinc finger, C4 type (two domains)	Domain
  PF00104	Hormone_recep	255 → 443	Ligand-binding domain of nuclear hormone receptor	Domain

• Sequence:

  MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
  TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
  IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
  CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERIL
  EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
  LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
  MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
  LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT

• Sequence length: 463