RPS6KB2 (ribosomal protein S6 kinase B2)

Gene

• Entrez ID: 6199
• Gene name: Ribosomal protein S6 kinase B2
• Gene symbol: RPS6KB2
• Synonyms: KLS, P70-beta, P70-beta-1, P70-beta-2, S6K-beta2, S6K2, S6KB, S6KI(2), S6Kbeta, SRK, STK14B, p70(S6K)-beta, p70S6Kb
• Chromosome: 11
• Chromosome location: 11q13.2
• Summary: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains a kinase catalytic domain and phosphorylates the S6 ribosomal protein and eukaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation. [provided by RefSeq, Jan 2015]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027691	hsa-miR-98-5p	Microarray	19088304
MIRT029811	hsa-miR-26b-5p	Microarray	19088304
MIRT036102	hsa-miR-1296-5p	CLASH	23622248
MIRT734060	hsa-miR-193a-3p	Luciferase reporter assay, qRT-PCR, Western blot	24469061

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004672	Function	Protein kinase activity	TAS	9804755
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004711	Function	Ribosomal protein S6 kinase activity	IBA	21873635
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0006412	Process	Translation	TAS	9804755
GO:0007165	Process	Signal transduction	TAS	9804755
GO:0018105	Process	Peptidyl-serine phosphorylation	IBA	21873635
GO:0031929	Process	TOR signaling	IBA	21873635
GO:0031929	Process	TOR signaling	IMP	29750193
GO:0042277	Function	Peptide binding	IEA
GO:0043491	Process	Protein kinase B signaling	IEA
GO:0045948	Process	Positive regulation of translational initiation	IMP	16763566
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA

Other IDs

• MIM: 608939
• HGNC: 10437
• e!Ensembl: ENSG00000175634

Protein

• UniProt ID: Q9UBS0
• Protein name: Ribosomal protein S6 kinase beta-2 (S6K-beta-2) (S6K2) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 2) (P70S6K2) (p70-S6K 2) (S6 kinase-related kinase) (SRK) (Serine/threonine-protein kinase 14B) (p70 ribosomal S6 kinase beta) (S6K-beta) (p70 S6 kinase beta) (p70 S6K-beta) (p70 S6KB) (p70-beta)
• Protein function: Phosphorylates specifically ribosomal protein S6 (PubMed:29750193). Seems to act downstream of mTOR signaling in response to growth factors and nutrients to promote cell proliferation, cell growth and cell cycle progression in an alternative pathway regulated by MEAK7 (PubMed:29750193).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	67 → 328	Protein kinase domain	Domain
  PF00433	Pkinase_C	349 → 389	Protein kinase C terminal domain	Family

• Sequence:

  MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPE
  RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
  NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
  ALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
  LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLALPPYLTPDARDLV
  KKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDT
  RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRA
  PVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKKSKRGRGRP
  GR

• Sequence length: 482