GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

RPS27A (ribosomal protein S27a)

Gene

6233

Ribosomal protein S27a

RPS27A

CEP80, HEL112, S27A, UBA80, UBC, UBCEP1, UBCEP80

2p16.1

Ubiquitin, a highly conserved protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome, is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. When expressed in yeast, the protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a. Ribosomal protein S27a is a component of the 40S subunit of the ribosome and belongs to the S27AE family of ribosomal proteins. It contains C4-type zinc finger domains and is located in the cytoplasm. Pseudogenes derived from this gene are present in the genome. As with ribosomal protein S27a, ribosomal protein L40 is also synthesized as a fusion protein with ubiquitin; similarly, ribosomal protein S30 is synthesized as a fusion protein with the ubiquitin-like protein fubi. Multiple alternatively spliced transcript variants that encode the same proteins have been identified.[provided by RefSeq, Sep 2008]

Show/Hide all(182)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046153	hsa-miR-30b-5p	CLASH	23622248
MIRT046242	hsa-miR-23b-3p	CLASH	23622248
MIRT047980	hsa-miR-30c-5p	CLASH	23622248
MIRT050094	hsa-miR-26a-5p	CLASH	23622248
MIRT050798	hsa-miR-17-5p	CLASH	23622248
MIRT050798	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT050798	hsa-miR-17-5p	PAR-CLIP	24398324
MIRT050798	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT050798	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT050798	hsa-miR-17-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT050798	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT448338	hsa-miR-578	PAR-CLIP	22100165
MIRT448339	hsa-miR-643	PAR-CLIP	22100165
MIRT464836	hsa-miR-510-3p	PAR-CLIP	23592263
MIRT464836	hsa-miR-510-3p	PAR-CLIP	24398324
MIRT464836	hsa-miR-510-3p	PAR-CLIP	23446348
MIRT464836	hsa-miR-510-3p	PAR-CLIP	22012620
MIRT464836	hsa-miR-510-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464836	hsa-miR-510-3p	PAR-CLIP	20371350
MIRT464837	hsa-miR-653-5p	PAR-CLIP	23592263
MIRT464837	hsa-miR-653-5p	PAR-CLIP	24398324
MIRT464837	hsa-miR-653-5p	PAR-CLIP	23446348
MIRT464837	hsa-miR-653-5p	PAR-CLIP	22012620
MIRT464837	hsa-miR-653-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT464837	hsa-miR-653-5p	PAR-CLIP	20371350
MIRT464838	hsa-miR-106a-3p	PAR-CLIP	23592263
MIRT464838	hsa-miR-106a-3p	PAR-CLIP	24398324
MIRT464838	hsa-miR-106a-3p	PAR-CLIP	23446348
MIRT464838	hsa-miR-106a-3p	PAR-CLIP	22012620
MIRT464838	hsa-miR-106a-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464838	hsa-miR-106a-3p	PAR-CLIP	20371350
MIRT464839	hsa-miR-488-3p	PAR-CLIP	23592263
MIRT464839	hsa-miR-488-3p	PAR-CLIP	24398324
MIRT464839	hsa-miR-488-3p	PAR-CLIP	23446348
MIRT464839	hsa-miR-488-3p	PAR-CLIP	22012620
MIRT464839	hsa-miR-488-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464839	hsa-miR-488-3p	PAR-CLIP	20371350
MIRT464840	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT464840	hsa-miR-6730-5p	PAR-CLIP	24398324
MIRT464840	hsa-miR-6730-5p	PAR-CLIP	23446348
MIRT464840	hsa-miR-6730-5p	PAR-CLIP	22012620
MIRT464840	hsa-miR-6730-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT464840	hsa-miR-6730-5p	PAR-CLIP	20371350
MIRT464841	hsa-miR-5681a	PAR-CLIP	23592263
MIRT464841	hsa-miR-5681a	PAR-CLIP	24398324
MIRT464841	hsa-miR-5681a	PAR-CLIP	23446348
MIRT464841	hsa-miR-5681a	PAR-CLIP	22012620
MIRT464841	hsa-miR-5681a	PAR-CLIP, HITS-CLIP	21572407
MIRT464841	hsa-miR-5681a	PAR-CLIP	20371350
MIRT464842	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT464842	hsa-miR-519c-3p	PAR-CLIP	24398324
MIRT464842	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT464842	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT464842	hsa-miR-519c-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464842	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT464843	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT464843	hsa-miR-519b-3p	PAR-CLIP	24398324
MIRT464843	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT464843	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT464843	hsa-miR-519b-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464843	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT464844	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT464844	hsa-miR-519a-3p	PAR-CLIP	24398324
MIRT464844	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT464844	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT464844	hsa-miR-519a-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464844	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT464845	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT464845	hsa-miR-651-3p	PAR-CLIP	24398324
MIRT464845	hsa-miR-651-3p	PAR-CLIP	23446348
MIRT464845	hsa-miR-651-3p	PAR-CLIP	22012620
MIRT464845	hsa-miR-651-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464845	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT464846	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT464846	hsa-miR-526b-3p	PAR-CLIP	24398324
MIRT464846	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT464846	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT464846	hsa-miR-526b-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464846	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT464847	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT464847	hsa-miR-20a-5p	PAR-CLIP	24398324
MIRT464847	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT464847	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT464847	hsa-miR-20a-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT464847	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT464848	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT464848	hsa-miR-519d-3p	PAR-CLIP	24398324
MIRT464848	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT464848	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT464848	hsa-miR-519d-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464848	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT464849	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT464849	hsa-miR-20b-5p	PAR-CLIP	24398324
MIRT464849	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT464849	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT464849	hsa-miR-20b-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT464849	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT464850	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT464850	hsa-miR-93-5p	PAR-CLIP	24398324
MIRT464850	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT464850	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT464850	hsa-miR-93-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT464850	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT464851	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT464851	hsa-miR-106a-5p	PAR-CLIP	24398324
MIRT464851	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT464851	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT464851	hsa-miR-106a-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT464851	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT464852	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT464852	hsa-miR-106b-5p	PAR-CLIP	24398324
MIRT464852	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT464852	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT464852	hsa-miR-106b-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT464852	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT464853	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT464853	hsa-miR-454-3p	PAR-CLIP	24398324
MIRT464853	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT464853	hsa-miR-454-3p	PAR-CLIP	22012620
MIRT464853	hsa-miR-454-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464853	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464854	hsa-miR-4295	PAR-CLIP	23592263
MIRT464854	hsa-miR-4295	PAR-CLIP	24398324
MIRT464854	hsa-miR-4295	PAR-CLIP	23446348
MIRT464854	hsa-miR-4295	PAR-CLIP	22012620
MIRT464854	hsa-miR-4295	PAR-CLIP, HITS-CLIP	21572407
MIRT464854	hsa-miR-4295	PAR-CLIP	20371350
MIRT464855	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT464855	hsa-miR-301a-3p	PAR-CLIP	24398324
MIRT464855	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT464855	hsa-miR-301a-3p	PAR-CLIP	22012620
MIRT464855	hsa-miR-301a-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464855	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464856	hsa-miR-3666	PAR-CLIP	23592263
MIRT464856	hsa-miR-3666	PAR-CLIP	24398324
MIRT464856	hsa-miR-3666	PAR-CLIP	23446348
MIRT464856	hsa-miR-3666	PAR-CLIP	22012620
MIRT464856	hsa-miR-3666	PAR-CLIP, HITS-CLIP	21572407
MIRT464856	hsa-miR-3666	PAR-CLIP	20371350
MIRT464857	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT464857	hsa-miR-301b-3p	PAR-CLIP	24398324
MIRT464857	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT464857	hsa-miR-301b-3p	PAR-CLIP	22012620
MIRT464857	hsa-miR-301b-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464857	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464858	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT464858	hsa-miR-130b-3p	PAR-CLIP	24398324
MIRT464858	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT464858	hsa-miR-130b-3p	PAR-CLIP	22012620
MIRT464858	hsa-miR-130b-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464858	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464859	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT464859	hsa-miR-130a-3p	PAR-CLIP	24398324
MIRT464859	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT464859	hsa-miR-130a-3p	PAR-CLIP	22012620
MIRT464859	hsa-miR-130a-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT464859	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT505257	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT505257	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT505257	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT505258	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT505258	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT505258	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT505259	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT505259	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT505259	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT533380	hsa-miR-450a-1-3p	PAR-CLIP	22012620
MIRT533380	hsa-miR-450a-1-3p	PAR-CLIP	21572407
MIRT533380	hsa-miR-450a-1-3p	PAR-CLIP	20371350
MIRT533381	hsa-miR-6716-5p	PAR-CLIP	22012620
MIRT533381	hsa-miR-6716-5p	PAR-CLIP	21572407
MIRT533381	hsa-miR-6716-5p	PAR-CLIP	20371350
MIRT553209	hsa-miR-6885-3p	PAR-CLIP	21572407
MIRT697903	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT697904	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT697905	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT697906	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT697907	hsa-miR-665	HITS-CLIP	23313552
MIRT783317	hsa-miR-1273f	HITS-CLIP	27418678
MIRT784347	hsa-miR-2681-5p	HITS-CLIP	27418678
MIRT786631	hsa-miR-4756-3p	HITS-CLIP	27418678
MIRT786840	hsa-miR-4797-5p	HITS-CLIP	27418678

Show/Hide all(79)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS
GO:0000184	Process	Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000715	Process	Nucleotide-excision repair, DNA damage recognition	TAS
GO:0000717	Process	Nucleotide-excision repair, DNA duplex unwinding	TAS
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS
GO:0002756	Process	MyD88-independent toll-like receptor signaling pathway	TAS
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003735	Function	Structural constituent of ribosome	HDA	15883184
GO:0005515	Function	Protein binding	IPI	14755250, 15936278, 16189514, 20374249, 25416956, 32296183, 32814053
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	HDA	16791210
GO:0005737	Component	Cytoplasm	HDA	16791210
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006283	Process	Transcription-coupled nucleotide-excision repair	TAS
GO:0006294	Process	Nucleotide-excision repair, preincision complex assembly	TAS
GO:0006296	Process	Nucleotide-excision repair, DNA incision, 5'-to lesion	TAS
GO:0006297	Process	Nucleotide-excision repair, DNA gap filling	TAS
GO:0006412	Process	Translation	IC	8706699, 15883184
GO:0006413	Process	Translational initiation	TAS
GO:0006614	Process	SRP-dependent cotranslational protein targeting to membrane	TAS
GO:0006625	Process	Protein targeting to peroxisome	TAS
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS
GO:0007254	Process	JNK cascade	TAS
GO:0010008	Component	Endosome membrane	TAS
GO:0015935	Component	Small ribosomal subunit	HDA	15883184
GO:0016020	Component	Membrane	HDA	19946888
GO:0016055	Process	Wnt signaling pathway	TAS
GO:0016197	Process	Endosomal transport	TAS
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0016567	Process	Protein ubiquitination	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019058	Process	Viral life cycle	TAS
GO:0019068	Process	Virion assembly	TAS
GO:0019083	Process	Viral transcription	TAS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019941	Process	Modification-dependent protein catabolic process	IBA	21873635
GO:0019985	Process	Translesion synthesis	TAS
GO:0022627	Component	Cytosolic small ribosomal subunit	HDA	15883184
GO:0022627	Component	Cytosolic small ribosomal subunit	IBA	21873635
GO:0022627	Component	Cytosolic small ribosomal subunit	IDA	8706699
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031386	Function	Protein tag	IBA	21873635
GO:0031625	Function	Ubiquitin protein ligase binding	IBA	21873635
GO:0031982	Component	Vesicle	HDA	19190083
GO:0033683	Process	Nucleotide-excision repair, DNA incision	TAS
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0036297	Process	Interstrand cross-link repair	TAS
GO:0042276	Process	Error-prone translesion synthesis	TAS
GO:0042769	Process	DNA damage response, detection of DNA damage	TAS
GO:0043065	Process	Positive regulation of apoptotic process	TAS
GO:0043066	Process	Negative regulation of apoptotic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043657	Component	Host cell	IEA
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	TAS
GO:0051403	Process	Stress-activated MAPK cascade	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0061024	Process	Membrane organization	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	19199708, 20458337, 23533145
GO:0070423	Process	Nucleotide-binding oligomerization domain containing signaling pathway	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070911	Process	Global genome nucleotide-excision repair	TAS
GO:0070987	Process	Error-free translesion synthesis	TAS
GO:0075733	Process	Intracellular transport of virus	TAS

MIM	HGNC	e!Ensembl
191343	10417	ENSG00000143947

Protein

UniProt ID

P62979

Protein name

Ubiquitin-40S ribosomal protein S27a (Ubiquitin carboxyl extension protein 80) [Cleaved into: Ubiquitin; 40S ribosomal protein S27a (Small ribosomal subunit protein eS31)]

Protein function

[Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling.; [40S ribosomal protein S27a]: Component of the 40S subunit of the ribosome.

PDB

2KHW , 2KOX , 2KTF , 2KWU , 2KWV , 2L0F , 2L0T , 2XK5 , 3AXC , 3I3T , 3K9P , 3N30 , 3N32 , 3NHE , 3NOB , 3NS8 , 3PHD , 3PHW , 3TBL , 3VDZ , 4R62 , 4UG0 , 4V6X , 5A2Q , 5AJ0 , 5FLX , 5LKS , 5T2C , 5WVO , 5YDK , 6DC6 , 6EK0 , 6FEC , 6G18 , 6G51 , 6G53 , 6G5H , 6G5I , 6IP5 , 6IP6 , 6IP8 , 6J99 , 6KFP , 6KG6 , 6KIU , 6KIV , 6KIW , 6OLE , 6OLF , 6OLG , 6OLI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00240	ubiquitin	3 → 74	Ubiquitin family	Domain
PF01599	Ribosomal_S27	102 → 147	Ribosomal protein S27a	Domain

Sequence

MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK

Sequence length

156

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412