ROCK2 (Rho associated coiled-coil containing protein kinase 2)

Gene

• Entrez ID: 9475
• Gene name: Rho associated coiled-coil containing protein kinase 2
• Gene symbol: ROCK2
• Synonyms: ROCK-II
• Chromosome: 2
• Chromosome location: 2p25.1
• Summary: The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000494	hsa-miR-138-5p	qRT-PCR, Luciferase reporter assay, Western blot, Reporter assay;Other	20232393
MIRT006478	hsa-miR-124-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot, Reporter assay;qRT-PCR	21672940
MIRT052902	hsa-miR-142-3p	Luciferase reporter assay, qRT-PCR, Western blot	24743945
MIRT052902	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT054808	hsa-miR-139-5p	Luciferase reporter assay, Western blot, qRT-PCR	24942287
MIRT438203	hsa-miR-200c-3p	Luciferase reporter assay	24169343
MIRT438204	hsa-miR-200b-3p	Luciferase reporter assay	24169343
MIRT438204	hsa-miR-200b-3p	Luciferase reporter assay	26903801
MIRT448504	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT448505	hsa-miR-5007-3p	PAR-CLIP	22100165
MIRT448506	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT448507	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT448508	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT448509	hsa-miR-4495	PAR-CLIP	22100165
MIRT448510	hsa-miR-30b-5p	PAR-CLIP	22100165
MIRT448511	hsa-miR-30c-5p	PAR-CLIP	22100165
MIRT448512	hsa-miR-30e-5p	PAR-CLIP	22100165
MIRT448513	hsa-miR-30d-5p	PAR-CLIP	22100165
MIRT448514	hsa-miR-30a-5p	PAR-CLIP	22100165
MIRT542158	hsa-miR-1277-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT542159	hsa-miR-519e-5p	PAR-CLIP	21572407
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23313552
MIRT542160	hsa-miR-515-5p	PAR-CLIP	21572407
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23313552
MIRT542161	hsa-miR-190a-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT542162	hsa-miR-5695	PAR-CLIP	21572407
MIRT542162	hsa-miR-5695	HITS-CLIP	23824327
MIRT542162	hsa-miR-5695	HITS-CLIP	23313552
MIRT542163	hsa-miR-519d-5p	PAR-CLIP	21572407
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23313552
MIRT542164	hsa-miR-5011-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT542164	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT707463	hsa-miR-4455	HITS-CLIP	21572407
MIRT707464	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT707465	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT707466	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT707467	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT707468	hsa-miR-625-3p	HITS-CLIP	21572407
MIRT733322	hsa-miR-135a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25065599
MIRT735216	hsa-miR-144-5p	Luciferase reporter assay, qRT-PCR, Western blot	25912304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000281	Process	Mitotic cytokinesis	IBA	21873635
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	24065547
GO:0002931	Process	Response to ischemia	ISS
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003723	Function	RNA binding	HDA	22681889
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	16574662, 21147781
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	24305806, 29353861
GO:0004674	Function	Protein serine/threonine kinase activity	ISS	24305806
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	27853422
GO:0005198	Function	Structural molecule activity	NAS	9933571
GO:0005515	Function	Protein binding	IPI	17015463, 20230755, 30413785, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	IDA	17015463
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA	21873635
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	IDA	18559669
GO:0006939	Process	Smooth muscle contraction	TAS	12778124
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	IMP	25816133
GO:0007266	Process	Rho protein signal transduction	IBA	21873635
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	24065547
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	ISS
GO:0010628	Process	Positive regulation of gene expression	IMP	24065547
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010825	Process	Positive regulation of centrosome duplication	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	19181962
GO:0018105	Process	Peptidyl-serine phosphorylation	IMP	24305806
GO:0018105	Process	Peptidyl-serine phosphorylation	ISS	24305806
GO:0018107	Process	Peptidyl-threonine phosphorylation	IBA	21873635
GO:0018107	Process	Peptidyl-threonine phosphorylation	IMP	24305806, 29353861
GO:0018107	Process	Peptidyl-threonine phosphorylation	ISS
GO:0030155	Process	Regulation of cell adhesion	TAS	12778124
GO:0030335	Process	Positive regulation of cell migration	IMP	20232393
GO:0030866	Process	Cortical actin cytoskeleton organization	IBA	21873635
GO:0030866	Process	Cortical actin cytoskeleton organization	IGI	25816133
GO:0030866	Process	Cortical actin cytoskeleton organization	IMP	25816133
GO:0031032	Process	Actomyosin structure organization	IBA	21873635
GO:0031644	Process	Regulation of nervous system process	ISS
GO:0032723	Process	Positive regulation of connective tissue growth factor production	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	TAS	12778124
GO:0035509	Process	Negative regulation of myosin-light-chain-phosphatase activity	IGI	25816133
GO:0035509	Process	Negative regulation of myosin-light-chain-phosphatase activity	IMP	25816133
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0039694	Process	Viral RNA genome replication	IMP	19376974
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IMP	29353861
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	ISS
GO:0045616	Process	Regulation of keratinocyte differentiation	IMP	19997641
GO:0046872	Function	Metal ion binding	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048511	Process	Rhythmic process	IEA
GO:0048598	Process	Embryonic morphogenesis	IBA	21873635
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0051246	Process	Regulation of protein metabolic process	ISS	24305806
GO:0051298	Process	Centrosome duplication	IMP	17015463
GO:0051492	Process	Regulation of stress fiber assembly	TAS	12778124
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	20232393
GO:0051893	Process	Regulation of focal adhesion assembly	TAS	12778124
GO:0061157	Process	MRNA destabilization	ISS
GO:0070168	Process	Negative regulation of biomineral tissue development	ISS
GO:0071394	Process	Cellular response to testosterone stimulus	IMP	24065547
GO:0071559	Process	Response to transforming growth factor beta	ISS
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IBA	21873635
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IMP	24065547
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	TAS	28679962
GO:0072659	Process	Protein localization to plasma membrane	IGI	25816133
GO:0072659	Process	Protein localization to plasma membrane	IMP	25816133
GO:0090271	Process	Positive regulation of fibroblast growth factor production	ISS
GO:0097746	Process	Blood vessel diameter maintenance	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:0110061	Process	Regulation of angiotensin-activated signaling pathway	ISS
GO:0150033	Process	Negative regulation of protein localization to lysosome	IMP	24305806
GO:1900037	Process	Regulation of cellular response to hypoxia	ISS
GO:1901888	Process	Regulation of cell junction assembly	IBA	21873635
GO:1902004	Process	Positive regulation of amyloid-beta formation	IMP	24305806
GO:1902004	Process	Positive regulation of amyloid-beta formation	ISS	24305806
GO:1902961	Process	Positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process	IMP	24305806
GO:1902961	Process	Positive regulation of aspartic-type endopeptidase activity involved in amyloid precursor protein catabolic process	ISS	24305806
GO:1902966	Process	Positive regulation of protein localization to early endosome	IMP	24305806
GO:1902993	Process	Positive regulation of amyloid precursor protein catabolic process	IMP	24305806
GO:1902993	Process	Positive regulation of amyloid precursor protein catabolic process	ISS	24305806
GO:1903140	Process	Regulation of establishment of endothelial barrier	IGI	25816133
GO:1903140	Process	Regulation of establishment of endothelial barrier	IMP	25816133
GO:1903347	Process	Negative regulation of bicellular tight junction assembly	IGI	25816133
GO:1905145	Process	Cellular response to acetylcholine	ISS
GO:1905205	Process	Positive regulation of connective tissue replacement	ISS
GO:1990776	Process	Response to angiotensin	ISS
GO:2000114	Process	Regulation of establishment of cell polarity	TAS	20803696
GO:2000145	Process	Regulation of cell motility	TAS	12778124

Other IDs

• MIM: 604002
• HGNC: 10252
• e!Ensembl: ENSG00000134318

Protein

• UniProt ID: O75116
• Protein name: Rho-associated protein kinase 2 (EC 2.7.11.1) (Rho kinase 2) (Rho-associated, coiled-coil-containing protein kinase 2) (Rho-associated, coiled-coil-containing protein kinase II) (ROCK-II) (p164 ROCK-2)
• Protein function: Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of ADD1, BRCA2, CNN1, EZR, DPYSL2, EP300, MSN, MYL9/MLC2, NPM1, RDX, PPP1R12A and VIM. Phosphorylates SORL1 and IRF4. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Positively regulates the activation of p42/MAPK1-p44/MAPK3 and of p90RSK/RPS6KA1 during myogenic differentiation. Plays an important role in the timely initiation of centrosome duplication. Inhibits keratinocyte terminal differentiation. May regulate closure of the eyelids and ventral body wall through organization of actomyosin bundles. Plays a critical role in the regulation of spine and synaptic properties in the hippocampus. Plays an important role in generating the circadian rhythm of the aortic myofilament Ca(2+) sensitivity and vascular contractility by modulating the myosin light chain phosphorylation.
• PDB: 4L6Q, 4WOT, 5U7Q, 5U7R, 6ED6, 6P5M, 6P5P, 7JNT, 7JOV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	92 → 354	Protein kinase domain	Domain
  PF08912	Rho_Binding	978 → 1046	Rho Binding	Coiled-coil

• Sequence:

  MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
  ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
  KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNL
  MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
  ETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLV
  GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWH
  WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
  LLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKT
  AKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
  EDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR
  DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRICGLEEDLKNGKI
  LLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNK
  IYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLK
  QKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN
  LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQK
  KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
  LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQF
  EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQ
  MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPG
  DAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
  DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG
  HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
  ISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
  QLAPNKPS

• Sequence length: 1388