RNF5 (ring finger protein 5)

Gene

• Entrez ID: 6048
• Gene name: Ring finger protein 5
• Gene symbol: RNF5
• Synonyms: RING5, RMA1
• Chromosome: 6
• Chromosome location: 6p21.32
• Summary: The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT042288	hsa-miR-484	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	19269966
GO:0005515	Function	Protein binding	IPI	12861019, 14667819, 16901789, 19269966, 19549727, 20152160, 24019521, 25416956, 25759021, 31515488, 32296183, 32814053
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0008270	Function	Zinc ion binding	TAS	9533025
GO:0009617	Process	Response to bacterium	IEA
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	IGI	24019521
GO:0031648	Process	Protein destabilization	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0036503	Process	ERAD pathway	IMP	24019521
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0044257	Process	Cellular protein catabolic process	IMP	19285439
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IEA
GO:0044390	Function	Ubiquitin-like protein conjugating enzyme binding	IBA	21873635
GO:0044877	Function	Protein-containing complex binding	IPI	24019521
GO:0055085	Process	Transmembrane transport	TAS
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:0061630	Function	Ubiquitin protein ligase activity	TAS	24019521
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	19269966
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	19285439
GO:0071712	Process	ER-associated misfolded protein catabolic process	IBA	21873635
GO:0071712	Process	ER-associated misfolded protein catabolic process	IMP	19269966
GO:1904380	Process	Endoplasmic reticulum mannose trimming	TAS
GO:2000785	Process	Regulation of autophagosome assembly	IEA

Other IDs

• MIM: 602677
• HGNC: 10068
• e!Ensembl: ENSG00000204308

Protein

• UniProt ID: Q99942
• Protein name: E3 ubiquitin-protein ligase RNF5 (EC 2.3.2.27) (Protein G16) (RING finger protein 5) (RING-type E3 ubiquitin transferase RNF5) (Ram1 homolog) (HsRma1)
• Protein function: Has E2-dependent E3 ubiquitin-protein ligase activity. May function together with E2 ubiquitin-conjugating enzymes UBE2D1/UBCH5A and UBE2D2/UBC4. Mediates ubiquitination of PXN/paxillin and Salmonella type III secreted protein sopA. May be involved in regulation of cell motility and localization of PXN/paxillin. Mediates the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD; the ubiquitination appears to involve E2 ubiquitin-conjugating enzyme UBE2N. Mediates the 'Lys-48'-linked polyubiquitination of STING1 at 'Lys-150' leading to its proteasomal degradation; the ubiquitination occurs in mitochondria after viral transfection and regulates antiviral responses.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13920	zf-C3HC4_3	23 → 73		Domain

• Sequence:

  MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPE
  RQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGF
  HFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
  

• Sequence length: 180