RAPGEF3 (Rap guanine nucleotide exchange factor 3)

Gene

• Entrez ID: 10411
• Gene name: Rap guanine nucleotide exchange factor 3
• Gene symbol: RAPGEF3
• Synonyms: CAMP-GEFI, EPAC, EPAC1, HSU79275, bcm910
• Chromosome: 12
• Chromosome location: 12q13.11

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019181	hsa-miR-335-5p	Microarray	18185580
MIRT023183	hsa-miR-124-3p	Microarray	18668037
MIRT527551	hsa-miR-4290	PAR-CLIP	22012620
MIRT527552	hsa-miR-4286	PAR-CLIP	22012620
MIRT527553	hsa-miR-4714-3p	PAR-CLIP	22012620
MIRT527554	hsa-miR-6782-3p	PAR-CLIP	22012620

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IMP	21840392
GO:0005515	Function	Protein binding	IPI	21393242
GO:0005886	Component	Plasma membrane	IDA	21047789
GO:0005886	Component	Plasma membrane	TAS
GO:0005902	Component	Microvillus	IDA	21047789
GO:0007165	Process	Signal transduction	TAS	9853756
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	TAS	10777494
GO:0019904	Function	Protein domain specific binding	IPI	21047789
GO:0019933	Process	CAMP-mediated signaling	NAS	16177794
GO:0030027	Component	Lamellipodium	IDA	21047789
GO:0030175	Component	Filopodium	IDA	21047789
GO:0030552	Function	CAMP binding	IEA
GO:0030864	Component	Cortical actin cytoskeleton	IDA	21047789
GO:0032486	Process	Rap protein signal transduction	IMP	21840392
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	23867755
GO:0034242	Process	Negative regulation of syncytium formation by plasma membrane fusion	IMP	23867755
GO:0043547	Process	Positive regulation of GTPase activity	IMP	21840392
GO:0045766	Process	Positive regulation of angiogenesis	IMP	21393242
GO:0046827	Process	Positive regulation of protein export from nucleus	IDA	23867755
GO:0050796	Process	Regulation of insulin secretion	TAS
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	21840392
GO:0060143	Process	Positive regulation of syncytium formation by plasma membrane fusion	IMP	23867755
GO:0061028	Process	Establishment of endothelial barrier	IMP	21840392
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071320	Process	Cellular response to cAMP	IDA	21840392
GO:1901985	Process	Positive regulation of protein acetylation	IMP	23867755
GO:2000249	Process	Regulation of actin cytoskeleton reorganization	IMP	21840392
GO:2000615	Process	Regulation of histone H3-K9 acetylation	IMP	23867755

Other IDs

• MIM: 606057
• HGNC: 16629
• e!Ensembl: ENSG00000079337

Protein

• UniProt ID: O95398
• Protein name: Rap guanine nucleotide exchange factor 3 (Exchange factor directly activated by cAMP 1) (Exchange protein directly activated by cAMP 1) (EPAC 1) (Rap1 guanine-nucleotide-exchange factor directly activated by cAMP) (cAMP-regulated guanine nucleotide exchange factor I) (cAMP-GEFI)
• Protein function: Guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP. Through simultaneous binding of PDE3B to RAPGEF3 and PIK3R6 is assembled in a signaling complex in which it activates the PI3K gamma complex and which is involved in angiogenesis. Plays a role in the modulation of the cAMP-induced dynamic control of endothelial barrier function through a pathway that is independent on Rho-mediated signaling. Required for the actin rearrangement at cell-cell junctions, such as stress fibers and junctional actin.
• PDB: 6H7E
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00610	DEP	114 → 184	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain
  PF00027	cNMP_binding	265 → 348	Cyclic nucleotide-binding domain	Domain
  PF00618	RasGEF_N	387 → 493	RasGEF N-terminal motif	Domain
  PF00617	RasGEF	665 → 843	RasGEF domain	Family

• Sequence:

  MKVGWPGESCWQVGLAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLL
  EHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRK
  YHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQ
  FYRFPGPEPEPVRTHEMEEELAEAVALLSQRGPDALLTVALRKPPGQRTDEELDLIFEEL
  LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
  VTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
  KVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDSSAHDPTETFLSD
  FLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSML
  HTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWL
  PNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQV
  LVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELIPHPDQLGPTVGSAEGLDL
  VSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVAT
  ELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKV
  RKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINFE
  KMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWA
  YVQQLKVIDNQRELSRLSRELEP

• Sequence length: 923