RAP1B (RAP1B, member of RAS oncogene family)

Gene

• Entrez ID: 5908
• Gene name: RAP1B, member of RAS oncogene family
• Gene symbol: RAP1B
• Synonyms: K-REV, RAL1B
• Chromosome: 12
• Chromosome location: 12q15
• Summary: This gene encodes a member of the RAS-like small GTP-binding protein superfamily. Members of this family regulate multiple cellular processes including cell adhesion and growth and differentiation. This protein localizes to cellular membranes and has been shown to regulate integrin-mediated cell signaling. This protein also plays a role in regulating outside-in signaling in platelets. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 5, 6 and 9. [provided by RefSeq, Oct 2011]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006853	hsa-miR-518b	Luciferase reporter assay	22958893
MIRT020552	hsa-miR-155-5p	Proteomics	18668040
MIRT023540	hsa-miR-1-3p	Proteomics	18668040
MIRT028850	hsa-miR-26b-5p	Microarray	19088304
MIRT054562	hsa-miR-181a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	24573637
MIRT054563	hsa-miR-181b-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	24573637
MIRT054564	hsa-miR-181c-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	24573637
MIRT054565	hsa-miR-181d-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	24573637
MIRT054750	hsa-miR-28-5p	Luciferase reporter assay, QRTPCR, Western blot	24843176
MIRT054750	hsa-miR-28-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27729617
MIRT054807	hsa-miR-139-5p	Luciferase reporter assay, Western blot, qRT-PCR	24942287
MIRT054807	hsa-miR-139-5p	PAR-CLIP	23592263
MIRT188209	hsa-miR-19a-3p	PAR-CLIP	23446348
MIRT188209	hsa-miR-19a-3p	PAR-CLIP	27292025
MIRT188210	hsa-miR-19b-3p	PAR-CLIP	23446348
MIRT188210	hsa-miR-19b-3p	PAR-CLIP	27292025
MIRT188212	hsa-miR-875-3p	PAR-CLIP	23446348
MIRT188212	hsa-miR-875-3p	PAR-CLIP	27292025
MIRT188214	hsa-miR-3609	PAR-CLIP	23446348
MIRT188214	hsa-miR-3609	PAR-CLIP	27292025
MIRT188215	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT188215	hsa-miR-548ah-5p	PAR-CLIP	27292025
MIRT188216	hsa-miR-3978	PAR-CLIP	23446348
MIRT188216	hsa-miR-3978	PAR-CLIP	27292025
MIRT188217	hsa-miR-8062	PAR-CLIP	23446348
MIRT188217	hsa-miR-8062	PAR-CLIP	27292025
MIRT188226	hsa-miR-1243	PAR-CLIP	23446348
MIRT188226	hsa-miR-1243	PAR-CLIP	27292025
MIRT188227	hsa-miR-3654	PAR-CLIP	23446348
MIRT188227	hsa-miR-3654	PAR-CLIP	27292025
MIRT188232	hsa-miR-101-3p	qRT-PCR, Luciferase reporter assay, Western blot	24697700
MIRT188267	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT188269	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT188271	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT188272	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT188273	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT188274	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT188275	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT188276	hsa-miR-651-3p	PAR-CLIP	21572407
MIRT188277	hsa-miR-3613-3p	PAR-CLIP	21572407
MIRT188278	hsa-miR-4495	PAR-CLIP	21572407
MIRT274621	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT274622	hsa-miR-4261	PAR-CLIP	21572407
MIRT274623	hsa-miR-4496	PAR-CLIP	21572407
MIRT438723	hsa-miR-100-5p	Luciferase reporter assay, qRT-PCR, Western blot	24626817
MIRT469590	hsa-miR-580-3p	PAR-CLIP	23592263
MIRT469591	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT469592	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT469593	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT469594	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT469595	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT469596	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT513721	hsa-miR-208b-5p	PAR-CLIP	23446348
MIRT513721	hsa-miR-208b-5p	PAR-CLIP	27292025
MIRT513722	hsa-miR-208a-5p	PAR-CLIP	23446348
MIRT513722	hsa-miR-208a-5p	PAR-CLIP	27292025
MIRT546831	hsa-miR-6883-3p	PAR-CLIP	21572407
MIRT546832	hsa-miR-642b-5p	PAR-CLIP	21572407
MIRT546833	hsa-miR-454-5p	PAR-CLIP	21572407
MIRT546834	hsa-miR-380-3p	PAR-CLIP	21572407
MIRT546835	hsa-miR-411-3p	PAR-CLIP	21572407
MIRT546836	hsa-miR-379-3p	PAR-CLIP	21572407
MIRT554920	hsa-miR-510-3p	PAR-CLIP	21572407
MIRT554921	hsa-miR-422a	PAR-CLIP	21572407
MIRT554922	hsa-miR-378i	PAR-CLIP	21572407
MIRT554923	hsa-miR-378h	PAR-CLIP	21572407
MIRT554924	hsa-miR-378f	PAR-CLIP	21572407
MIRT554925	hsa-miR-378e	PAR-CLIP	21572407
MIRT554926	hsa-miR-378d	PAR-CLIP	21572407
MIRT554927	hsa-miR-378c	PAR-CLIP	21572407
MIRT554928	hsa-miR-378b	PAR-CLIP	21572407
MIRT554929	hsa-miR-378a-3p	PAR-CLIP	21572407
MIRT554930	hsa-miR-4638-3p	PAR-CLIP	21572407
MIRT554931	hsa-miR-5692c	PAR-CLIP	21572407
MIRT554932	hsa-miR-5692b	PAR-CLIP	21572407
MIRT554933	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT733848	hsa-miR-518f-3p	Microarray, qRT-PCR	27144577

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IBA	21873635
GO:0003924	Function	GTPase activity	IDA	18309292
GO:0005515	Function	Protein binding	IPI	16452984, 18309292, 18660803, 21988832, 22705156, 25416956, 26780829, 32296183, 32814053
GO:0005525	Function	GTP binding	IBA	21873635
GO:0005525	Function	GTP binding	IDA	18309292
GO:0005811	Component	Lipid droplet	IDA	14741744
GO:0005829	Component	Cytosol	IDA	18582561
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IDA	20332120
GO:0008283	Process	Cell population proliferation	IEA
GO:0009743	Process	Response to carbohydrate	IEA
GO:0016020	Component	Membrane	TAS	2105724, 2123345
GO:0019003	Function	GDP binding	IBA	21873635
GO:0019003	Function	GDP binding	IDA	18309292
GO:0030033	Process	Microvillus assembly	IMP	22797597
GO:0032486	Process	Rap protein signal transduction	IBA	21873635
GO:0032486	Process	Rap protein signal transduction	IMP	21840392
GO:0033625	Process	Positive regulation of integrin activation	IMP	19461049
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0035690	Process	Cellular response to drug	IEA
GO:0035722	Process	Interleukin-12-mediated signaling pathway	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0044877	Function	Protein-containing complex binding	IDA	23209302
GO:0045121	Component	Membrane raft	IDA	18582561
GO:0045955	Process	Negative regulation of calcium ion-dependent exocytosis	IEA
GO:0061028	Process	Establishment of endothelial barrier	IMP	21840392
GO:0070062	Component	Extracellular exosome	HDA	19199708, 20458337
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071320	Process	Cellular response to cAMP	IBA	21873635
GO:0071320	Process	Cellular response to cAMP	IDA	21840392
GO:0097211	Process	Cellular response to gonadotropin-releasing hormone	IEA
GO:1901888	Process	Regulation of cell junction assembly	IMP	21840392
GO:2000114	Process	Regulation of establishment of cell polarity	IMP	20332120
GO:2000301	Process	Negative regulation of synaptic vesicle exocytosis	IBA	21873635

Other IDs

• MIM: 179530
• HGNC: 9857
• e!Ensembl: ENSG00000127314

Protein

• UniProt ID: P61224
• Protein name: Ras-related protein Rap-1b (EC 3.6.5.2) (GTP-binding protein smg p21B)
• Protein function: GTP-binding protein that possesses intrinsic GTPase activity. Contributes to the polarizing activity of KRIT1 and CDH5 in the establishment and maintenance of correct endothelial cell polarity and vascular lumen. Required for the localization of phosphorylated PRKCZ, PARD3 and TIAM1 to the cell junction. Plays a role in the establishment of basal endothelial barrier function.
• PDB: 3BRW, 3CF6, 4DXA, 4HDO, 4HDQ, 4M8N, 4MGI, 4MGK, 4MGY, 4MGZ, 4MH0, 5KHO, 6AXF, 6BA6, 6KYK, 6OQ3, 6OQ4, 6UZK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	5 → 167	Ras family	Domain

• Sequence:

  MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG
  TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL
  EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS
  CQLL

• Sequence length: 184