RAC3 (Rac family small GTPase 3)

Gene

• Entrez ID: 5881
• Gene name: Rac family small GTPase 3
• Gene symbol: RAC3
• Synonyms: -
• Chromosome: 17
• Chromosome location: 17q25.3
• Summary: The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1064797229	G>A	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs1379395211	C>G,T	Likely-pathogenic	Coding sequence variant, missense variant
rs1568018697	C>T	Association, pathogenic	Missense variant, coding sequence variant
rs1568018920	A>T	Association, pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT038692	hsa-miR-30c-2-3p	CLASH	23622248
MIRT346158	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT346160	hsa-miR-568	PAR-CLIP	20371350
MIRT346163	hsa-miR-3163	PAR-CLIP	20371350
MIRT346165	hsa-miR-3662	PAR-CLIP	20371350
MIRT346166	hsa-miR-4434	PAR-CLIP	20371350
MIRT346167	hsa-miR-4516	PAR-CLIP	20371350
MIRT346168	hsa-miR-4531	PAR-CLIP	20371350
MIRT346169	hsa-miR-5703	PAR-CLIP	20371350
MIRT346171	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT560901	hsa-miR-5701	PAR-CLIP	20371350
MIRT560902	hsa-miR-6802-5p	PAR-CLIP	20371350
MIRT560903	hsa-miR-6865-5p	PAR-CLIP	20371350
MIRT560904	hsa-miR-6815-5p	PAR-CLIP	20371350
MIRT718778	hsa-miR-6829-5p	HITS-CLIP	19536157
MIRT718779	hsa-miR-6762-3p	HITS-CLIP	19536157
MIRT718780	hsa-miR-7106-3p	HITS-CLIP	19536157
MIRT718781	hsa-miR-3194-5p	HITS-CLIP	19536157
MIRT718782	hsa-miR-4258	HITS-CLIP	19536157
MIRT718783	hsa-miR-484	HITS-CLIP	19536157
MIRT718784	hsa-miR-3155b	HITS-CLIP	19536157
MIRT718785	hsa-miR-3155a	HITS-CLIP	19536157
MIRT718786	hsa-miR-4446-3p	HITS-CLIP	19536157
MIRT718787	hsa-miR-4687-5p	HITS-CLIP	19536157

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IBA	21873635
GO:0003924	Function	GTPase activity	IDA	11956649
GO:0005515	Function	Protein binding	IPI	11956649, 21217774, 32296183
GO:0005525	Function	GTP binding	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005938	Component	Cell cortex	IBA	21873635
GO:0007015	Process	Actin filament organization	IBA	21873635
GO:0007163	Process	Establishment or maintenance of cell polarity	IBA	21873635
GO:0007264	Process	Small GTPase mediated signal transduction	IEA
GO:0008360	Process	Regulation of cell shape	IBA	21873635
GO:0012505	Component	Endomembrane system	IDA	11956649
GO:0014041	Process	Regulation of neuron maturation	IEA
GO:0016055	Process	Wnt signaling pathway	IMP	29276006
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0021894	Process	Cerebral cortex GABAergic interneuron development	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030031	Process	Cell projection assembly	IDA	11956649
GO:0030036	Process	Actin cytoskeleton organization	IDA	11956649
GO:0030426	Component	Growth cone	IDA	16525025
GO:0030865	Process	Cortical cytoskeleton organization	IBA	21873635
GO:0031175	Process	Neuron projection development	IEA
GO:0031410	Component	Cytoplasmic vesicle	IBA	21873635
GO:0031941	Component	Filamentous actin	IDA	16525025
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA	21873635
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	IDA	11756406
GO:0035556	Process	Intracellular signal transduction	TAS	9252344
GO:0042995	Component	Cell projection	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0043005	Component	Neuron projection	IDA	16525025
GO:0043025	Component	Neuronal cell body	IDA	16525025
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA	21873635
GO:0045202	Component	Synapse	IEA
GO:0048306	Function	Calcium-dependent protein binding	IPI	11756406
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	11756406
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0050885	Process	Neuromuscular process controlling balance	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0051932	Process	Synaptic transmission, GABAergic	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071944	Component	Cell periphery	IDA	11756406
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IDA	11756406

Other IDs

• MIM: 602050
• HGNC: 9803
• e!Ensembl: ENSG00000169750

Protein

• UniProt ID: P60763
• Protein name: Ras-related C3 botulinum toxin substrate 3 (EC 3.6.5.2) (p21-Rac3)
• Protein function: Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner.
• PDB: 2C2H, 2G0N, 2IC5, 2OV2, 2QME, 6TM1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	5 → 178	Ras family	Domain

• Sequence:

  MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
  QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
  DDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP
  PVKKPGKKCTVF

• Sequence length: 192