PTPRJ (protein tyrosine phosphatase receptor type J)

Gene

• Entrez ID: 5795
• Gene name: Protein tyrosine phosphatase receptor type J
• Gene symbol: PTPRJ
• Synonyms: CD148, DEP1, HPTPeta, R-PTP-ETA, SCC1
• Chromosome: 11
• Chromosome location: 11p11.2
• Summary: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes, including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region containing five fibronectin type III repeats, a single transmembrane region, and a single intracytoplasmic catalytic domain, and thus represents a receptor-type PTP. This protein is present in all hematopoietic lineages, and was shown to negatively regulate T cell receptor signaling possibly through interfering with the phosphorylation of Phospholipase C Gamma 1 and Linker for Activation of T Cells. This protein can also dephosphorylate the PDGF beta receptor, and may be involved in UV-induced signal transduction. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1566734	A>C	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs121434507	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001514	hsa-miR-155-5p	pSILAC, Proteomics;Other	18668040
MIRT006477	hsa-miR-328-3p	qRT-PCR, Western blot	22564856
MIRT017530	hsa-miR-335-5p	Microarray	18185580
MIRT022460	hsa-miR-124-3p	Microarray	18668037
MIRT029278	hsa-miR-26b-5p	Microarray	19088304
MIRT031605	hsa-miR-16-5p	Proteomics	18668040
MIRT031605	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT049863	hsa-miR-31-5p	CLASH	23622248
MIRT130342	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT130343	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT130344	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT130353	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT130380	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT130382	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT130383	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT130394	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	23592263
MIRT469922	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT469922	hsa-miR-1277-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT469922	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT469923	hsa-miR-592	PAR-CLIP	23592263
MIRT469923	hsa-miR-592	PAR-CLIP	22012620
MIRT469924	hsa-miR-376a-5p	PAR-CLIP	23592263
MIRT469924	hsa-miR-376a-5p	PAR-CLIP	22012620
MIRT469924	hsa-miR-376a-5p	HITS-CLIP	23313552
MIRT469924	hsa-miR-376a-5p	HITS-CLIP	21572407
MIRT469925	hsa-miR-4672	PAR-CLIP	23592263
MIRT469925	hsa-miR-4672	PAR-CLIP	22012620
MIRT469925	hsa-miR-4672	HITS-CLIP	21572407
MIRT469926	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT469926	hsa-miR-597-5p	PAR-CLIP	22012620
MIRT469927	hsa-miR-376a-2-5p	PAR-CLIP	23592263
MIRT469927	hsa-miR-376a-2-5p	PAR-CLIP	22012620
MIRT469927	hsa-miR-376a-2-5p	HITS-CLIP	23313552
MIRT469927	hsa-miR-376a-2-5p	HITS-CLIP	21572407
MIRT469928	hsa-miR-190b	PAR-CLIP	23592263
MIRT469928	hsa-miR-190b	PAR-CLIP	22012620
MIRT469928	hsa-miR-190b	HITS-CLIP	23313552
MIRT469929	hsa-miR-190a-5p	PAR-CLIP	23592263
MIRT469929	hsa-miR-190a-5p	PAR-CLIP	22012620
MIRT469929	hsa-miR-190a-5p	HITS-CLIP	23313552
MIRT469930	hsa-miR-936	PAR-CLIP	23592263
MIRT469930	hsa-miR-936	PAR-CLIP	22012620
MIRT469930	hsa-miR-936	HITS-CLIP	23313552
MIRT469930	hsa-miR-936	HITS-CLIP	21572407
MIRT469931	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT469931	hsa-miR-511-3p	PAR-CLIP	22012620
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	23592263
MIRT469932	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT469932	hsa-miR-5011-5p	PAR-CLIP, HITS-CLIP	21572407
MIRT469933	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT469933	hsa-miR-6768-5p	PAR-CLIP	22012620
MIRT469933	hsa-miR-6768-5p	HITS-CLIP	21572407
MIRT534914	hsa-miR-4789-5p	PAR-CLIP	22012620
MIRT534914	hsa-miR-4789-5p	HITS-CLIP	23313552
MIRT534914	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT555121	hsa-miR-3591-5p	PAR-CLIP	21572407
MIRT555122	hsa-miR-190a-3p	PAR-CLIP, HITS-CLIP	21572407
MIRT555122	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT555123	hsa-miR-142-3p	PAR-CLIP	21572407
MIRT555124	hsa-miR-27b-5p	PAR-CLIP	21572407
MIRT555125	hsa-miR-4280	PAR-CLIP	21572407
MIRT622554	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT622555	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT654620	hsa-miR-3149	HITS-CLIP	23824327
MIRT654621	hsa-miR-1303	HITS-CLIP	23824327
MIRT654622	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT654623	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT739142	hsa-miR-2278	PAR-CLIP	26701625
MIRT739456	hsa-miR-27a-5p	PAR-CLIP	26701625
MIRT739487	hsa-miR-28-5p	PAR-CLIP	26701625
MIRT739551	hsa-miR-299-3p	PAR-CLIP	26701625
MIRT740174	hsa-miR-3139	PAR-CLIP	26701625
MIRT740464	hsa-miR-3158-3p	PAR-CLIP	26701625
MIRT741441	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT741484	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT742236	hsa-miR-3688-5p	PAR-CLIP	26701625
MIRT743506	hsa-miR-4265	PAR-CLIP	26701625
MIRT743514	hsa-miR-4266	PAR-CLIP	26701625
MIRT743801	hsa-miR-4296	PAR-CLIP	26701625
MIRT744040	hsa-miR-4322	PAR-CLIP	26701625
MIRT744146	hsa-miR-4417	PAR-CLIP	26701625
MIRT745408	hsa-miR-449a	PAR-CLIP	26701625
MIRT745440	hsa-miR-449b-5p	PAR-CLIP	26701625
MIRT750610	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT752330	hsa-miR-6132	PAR-CLIP	26701625
MIRT752904	hsa-miR-6501-3p	PAR-CLIP	26701625
MIRT753096	hsa-miR-6510-5p	PAR-CLIP	26701625
MIRT753827	hsa-miR-6721-5p	PAR-CLIP	26701625
MIRT757224	hsa-miR-6836-5p	PAR-CLIP	26701625
MIRT758817	hsa-miR-708-5p	PAR-CLIP	26701625
MIRT758823	hsa-miR-7106-3p	PAR-CLIP	26701625
MIRT760442	hsa-miR-891a-3p	PAR-CLIP	26701625

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001772	Component	Immunological synapse	IDA	12913111
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA	21873635
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	9531590, 10821867, 12913111, 18348712, 18936167, 19332538
GO:0004725	Function	Protein tyrosine phosphatase activity	IMP	9780142, 12475979
GO:0004725	Function	Protein tyrosine phosphatase activity	TAS
GO:0005161	Function	Platelet-derived growth factor receptor binding	IPI	10821867
GO:0005515	Function	Protein binding	IPI	10821867, 12370829, 12475979, 12771128, 16893970, 18936167, 19167335, 19494114, 23650535
GO:0005886	Component	Plasma membrane	IDA	9531590, 18348712, 19836242
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	7937872
GO:0005911	Component	Cell-cell junction	IDA	12370829, 19332538
GO:0006470	Process	Protein dephosphorylation	IBA	21873635
GO:0008013	Function	Beta-catenin binding	IPI	12370829
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	14709717, 16682945
GO:0009986	Component	Cell surface	IDA	12913111
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	14709717
GO:0016791	Function	Phosphatase activity	IDA	12062403, 12370829, 19494114
GO:0016791	Function	Phosphatase activity	IMP	11259588, 19836242
GO:0019901	Function	Protein kinase binding	IPI	19332538
GO:0030155	Process	Regulation of cell adhesion	IMP	12370829
GO:0030183	Process	B cell differentiation	ISS
GO:0030308	Process	Negative regulation of cell growth	IDA	14709717
GO:0030336	Process	Negative regulation of cell migration	IDA	16682945
GO:0032587	Component	Ruffle membrane	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IDA	9531590, 10821867, 12913111, 18348712, 18936167, 19332538
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IMP	9780142, 12475979
GO:0035579	Component	Specific granule membrane	TAS
GO:0035584	Process	Calcium-mediated signaling using intracellular calcium source	ISS
GO:0042059	Process	Negative regulation of epidermal growth factor receptor signaling pathway	IMP	19836242
GO:0043116	Process	Negative regulation of vascular permeability	IDA	19332538
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043407	Process	Negative regulation of MAP kinase activity	IBA	21873635
GO:0043407	Process	Negative regulation of MAP kinase activity	IDA	19494114
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0045295	Function	Gamma-catenin binding	IPI	12370829
GO:0045296	Function	Cadherin binding	IPI	28926625
GO:0045785	Process	Positive regulation of cell adhesion	IMP	21091576
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IMP	21091576
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	ISS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IDA	12913111
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IMP	9780142, 11259588
GO:0050918	Process	Positive chemotaxis	IDA	14709717
GO:0051019	Function	Mitogen-activated protein kinase binding	IPI	19494114
GO:0051894	Process	Positive regulation of focal adhesion assembly	IMP	21091576
GO:0051897	Process	Positive regulation of protein kinase B signaling	IMP	18936167
GO:0051898	Process	Negative regulation of protein kinase B signaling	IMP	19922411
GO:0060242	Process	Contact inhibition	NAS	7937872
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070097	Function	Delta-catenin binding	IPI	12370829, 19332538
GO:1905451	Process	Positive regulation of Fc-gamma receptor signaling pathway involved in phagocytosis	ISS

Other IDs

• MIM: 600925
• HGNC: 9673
• e!Ensembl: ENSG00000149177

Protein

• UniProt ID: Q12913
• Protein name: Receptor-type tyrosine-protein phosphatase eta (Protein-tyrosine phosphatase eta) (R-PTP-eta) (EC 3.1.3.48) (Density-enhanced phosphatase 1) (DEP-1) (HPTP eta) (Protein-tyrosine phosphatase receptor type J) (R-PTP-J) (CD antigen CD148)
• Protein function: Tyrosine phosphatase which dephosphorylates or contributes to the dephosphorylation of CTNND1, FLT3, PDGFRB, MET, RET (variant MEN2A), KDR, LYN, SRC, MAPK1, MAPK3, EGFR, TJP1, OCLN, PIK3R1 and PIK3R2. Plays a role in cell adhesion, migration, proliferation and differentiation. Involved in vascular development. Regulator of macrophage adhesion and spreading. Positively affects cell-matrix adhesion. Positive regulator of platelet activation and thrombosis. Negative regulator of cell proliferation. Negative regulator of PDGF-stimulated cell migration; through dephosphorylation of PDGFR. Positive regulator of endothelial cell survival, as well as of VEGF-induced SRC and AKT activation; through KDR dephosphorylation. Negative regulator of EGFR signaling pathway; through EGFR dephosphorylation. Enhances the barrier function of epithelial junctions during reassembly. Negatively regulates T-cell receptor (TCR) signaling. Upon T-cell TCR activation, it is up-regulated and excluded from the immunological synapses, while upon T-cell-antigen presenting cells (APC) disengagement, it is no longer excluded and can dephosphorylate PLCG1 and LAT to down-regulate prolongation of signaling.
• PDB: 2CFV, 2DLE, 2NZ6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00041	fn3	120 → 199	Fibronectin type III domain	Domain
  PF00041	fn3	368 → 445	Fibronectin type III domain	Domain
  PF18861	PTP_tm	835 → 1000	Transmembrane domain of protein tyrosine phosphatase, receptor type J	Family
  PF00102	Y_phosphatase	1065 → 1297	Protein-tyrosine phosphatase	Domain

• Sequence:

  MKPAAREARLPPRSPGLRWALPLLLLLLRLGQILCAGGTPSPIPDPSVATVATGENGITQ
  ISSTAESFHKQNGTGTPQVETNTSEDGESSGANDSLRTPEQGSNGTDGASQKTPSSTGPS
  PVFDIKAVSISPTNVILTWKSNDTAASEYKYVVKHKMENEKTITVVHQPWCNITGLRPAT
  SYVFSITPGIGNETWGDPRVIKVITEPIPVSDLRVALTGVRKAALSWSNGNGTASCRVLL
  ESIGSHEELTQDSRLQVNISGLKPGVQYNINPYLLQSNKTKGDPLGTEGGLDASNTERSR
  AGSPTAPVHDESLVGPVDPSSGQQSRDTEVLLVGLEPGTRYNATVYSQAANGTEGQPQAI
  EFRTNAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAV
  IPGLRSSTFYNITVCPVLGDIEGTPGFLQVHTPPVPVSDFRVTVVSTTEIGLAWSSHDAE
  SFQMHITQEGAGNSRVEITTNQSIIIGGLFPGTKYCFEIVPKGPNGTEGASRTVCNRTVP
  SAVFDIHVVYVTTTEMWLDWKSPDGASEYVYHLVIESKHGSNHTSTYDKAITLQGLIPGT
  LYNITISPEVDHVWGDPNSTAQYTRPSNVSNIDVSTNTTAATLSWQNFDDASPTYSYCLL
  IEKAGNSSNATQVVTDIGITDATVTELIPGSSYTVEIFAQVGDGIKSLEPGRKSFCTDPA
  SMASFDCEVVPKEPALVLKWTCPPGANAGFELEVSSGAWNNATHLESCSSENGTEYRTEV
  TYLNFSTSYNISITTVSCGKMAAPTRNTCTTGITDPPPPDGSPNITSVSHNSVKVKFSGF
  EASHGPIKAYAVILTTGEAGHPSADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSQSLSE
  VLKYEIDVGNESTTLGYYNGKLEPLGSYRACVAGFTNITFHPQNKGLIDGAESYVSFSRY
  SDAVSLPQDPGVICGAVFGCIFGALVIVTVGGFIFWRKKRKDAKNNEVSFSQIKPKKSKL
  IRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDIS
  RVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTK
  CVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHF
  TSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIE
  NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIY
  ENLAPVTTFGKTNGYIA

• Sequence length: 1337