GediPNet logo

PTPN1 (protein tyrosine phosphatase non-receptor type 1)
Gene
Gene SNPs Transcription factors Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5770
Gene nameGene Name - the full gene name approved by the HGNC.
Protein tyrosine phosphatase non-receptor type 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
PTPN1
SynonymsGene synonyms aliases
PTP1B
ChromosomeChromosome number
20
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.13
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP has been shown to act as a negative regulator of insulin signaling by dephosphorylating the phosphotryosine residues of insulin receptor kinase. This PTP was also reported to dephosphorylate epidermal growth factor receptor kinase, as well as JAK2 and TYK2 kinases, which implicated the role of this PTP in cell growth control, and cell response to interferon stimulation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2013]
SNPsSNP information provided by dbSNP.
Gene SNPs Transcription factors Other IDs
SNP ID Visualize variation Clinical significance Consequence
rs16989673 ->G Risk-factor 3 prime UTR variant
miRNAmiRNA information provided by mirtarbase database.
Gene SNPs Transcription factors Other IDs
miRTarBase ID miRNA Experiments Reference
MIRT003154 hsa-miR-210-3p 2DGE, immunoprecipitaion, Luciferase reporter assay, Mass spectrometry, Microarray, qRT-PCR, Western blot 19826008
MIRT007007 hsa-miR-122-5p Luciferase reporter assay 22807119
MIRT007351 hsa-miR-362-3p Western blot 23280316
MIRT019939 hsa-miR-375 Microarray 20215506
MIRT023987 hsa-miR-1-3p Proteomics 18668040
Transcription factors
Gene SNPs Transcription factors Other IDs
Transcription factor Regulation Reference
AR Unknown 22282656
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs Transcription factors Other IDs
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674
GO:0004725 Function Protein tyrosine phosphatase activity IDA 18074158, 21707536, 22169477
GO:0004725 Function Protein tyrosine phosphatase activity TAS
GO:0005158 Function Insulin receptor binding IEA
GO:0005515 Function Protein binding IPI 8702689, 8940134, 8999839, 9050838, 9355745, 9407132, 9418872, 9566916, 9600099, 10660596, 10889023, 11007774, 11106648, 11163213, 11506178, 11579209, 11694501, 11970898, 12023880, 12176037, 12237455, 12614164, 12634852, 12857726, 12907755, 14527337, 14722096, 15588987, 15821101, 158
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs Transcription factors Other IDs
MIM
HGNC
e!Ensembl
Protein
Gene SNPs Transcription factors Other IDs
UniProt ID P18031
Protein name Tyrosine-protein phosphatase non-receptor type 1 (EC 3.1.3.48) (Protein-tyrosine phosphatase 1B) (PTP-1B)
Protein function Tyrosine-protein phosphatase which acts as a regulator of endoplasmic reticulum unfolded protein response. Mediates dephosphorylation of EIF2AK3/PERK; inactivating the protein kinase activity of EIF2AK3/PERK. May play an important role in CKII- and p60c-src-induced signal transduction cascades. May regulate the EFNA5-EPHA3 signaling pathway which modulates cell reorganization and cell-cell repulsion. May also regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of MET.
PDB 1A5Y , 1AAX , 1BZC , 1BZH , 1BZJ , 1C83 , 1C84 , 1C85 , 1C86 , 1C87 , 1C88 , 1ECV , 1EEN , 1EEO , 1G1F , 1G1G , 1G1H , 1G7F , 1G7G , 1GFY , 1I57 , 1JF7 , 1KAK , 1KAV , 1L8G , 1LQF , 1NL9 , 1NNY , 1NO6 , 1NWE , 1NWL , 1NZ7 , 1OEM , 1OEO , 1OES , 1OET , 1OEU , 1OEV , 1ONY , 1ONZ , 1PA1 , 1PH0 , 1PTT , 1PTU , 1PTV , 1PTY , 1PXH , 1PYN , 1Q1M , 1Q6J , 1Q6M
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00102 Y_phosphatase
40 → 276
Protein-tyrosine phosphatase
 Domain
Sequence 
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
Sequence length 435
Interactions View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412