PSMF1 (proteasome inhibitor subunit 1)

Gene

• Entrez ID: 9491
• Gene name: Proteasome inhibitor subunit 1
• Gene symbol: PSMF1
• Synonyms: PI31
• Chromosome: 20
• Chromosome location: 20p13
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a protein that inhibits the activation of the proteasome by the 11S and 19S regulators. Alternative transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT039672	hsa-miR-615-3p	CLASH	23622248
MIRT043618	hsa-miR-151a-3p	CLASH	23622248
MIRT044684	hsa-miR-320a	CLASH	23622248
MIRT049749	hsa-miR-92a-3p	CLASH	23622248
MIRT470124	hsa-miR-518c-5p	PAR-CLIP	23592263
MIRT470125	hsa-miR-6515-5p	PAR-CLIP	23592263
MIRT470126	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT470127	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT470128	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT470129	hsa-miR-661	PAR-CLIP	23592263
MIRT470130	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT470131	hsa-miR-6736-3p	PAR-CLIP	23592263
MIRT470132	hsa-miR-4802-5p	PAR-CLIP	23592263
MIRT470133	hsa-miR-9500	PAR-CLIP	23592263
MIRT470134	hsa-miR-665	PAR-CLIP	23592263
MIRT718190	hsa-miR-6773-5p	HITS-CLIP	19536157
MIRT718191	hsa-miR-6724-5p	HITS-CLIP	19536157
MIRT718192	hsa-miR-296-5p	HITS-CLIP	19536157
MIRT718193	hsa-miR-6721-5p	HITS-CLIP	19536157
MIRT718194	hsa-miR-6775-3p	HITS-CLIP	19536157
MIRT718195	hsa-miR-1291	HITS-CLIP	19536157
MIRT718196	hsa-miR-6860	HITS-CLIP	19536157
MIRT718197	hsa-miR-612	HITS-CLIP	19536157
MIRT718198	hsa-miR-5189-5p	HITS-CLIP	19536157
MIRT718199	hsa-miR-3187-5p	HITS-CLIP	19536157
MIRT718200	hsa-miR-1285-3p	HITS-CLIP	19536157
MIRT718201	hsa-miR-939-3p	HITS-CLIP	19536157
MIRT718202	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT718203	hsa-miR-4292	HITS-CLIP	19536157
MIRT718204	hsa-miR-451b	HITS-CLIP	19536157

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004866	Function	Endopeptidase inhibitor activity	NAS	10764772
GO:0005515	Function	Protein binding	IPI	16000308, 16713569, 19060904, 25416956, 25910212, 26496610, 28514442, 31515488, 32296183, 32814053
GO:0005654	Component	Nucleoplasm	TAS
GO:0005783	Component	Endoplasmic reticulum	IDA	18495667
GO:0005829	Component	Cytosol	IDA	18495667
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	NAS	10764772
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	10764772
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0010951	Process	Negative regulation of endopeptidase activity	IEA
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016579	Process	Protein deubiquitination	TAS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042803	Function	Protein homodimerization activity	IDA	18495667
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0046982	Function	Protein heterodimerization activity	IPI	18495667
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	18495667
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070628	Function	Proteasome binding	IDA	10764772
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901799	Process	Negative regulation of proteasomal protein catabolic process	IDA	10764772
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

Other IDs

• MIM: 617858
• HGNC: 9571
• e!Ensembl: ENSG00000125818

Protein

• UniProt ID: Q92530
• Protein name: Proteasome inhibitor PI31 subunit (hPI31)
• Protein function: Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28.
• PDB: 2VT8, 4OUH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11566	PI31_Prot_N	11 → 149	PI31 proteasome regulator N-terminal	Family
  PF08577	PI31_Prot_C	153 → 248	PI31 proteasome regulator	Family

• Sequence:

  MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNN
  NKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDF
  HRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSR
  QPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPG
  ARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL

• Sequence length: 271