PSME3 (proteasome activator subunit 3)

Gene

• Entrez ID: 10197
• Gene name: Proteasome activator subunit 3
• Gene symbol: PSME3
• Synonyms: HEL-S-283, Ki, PA28-gamma, PA28G, PA28gamma, REG-GAMMA
• Chromosome: 17
• Chromosome location: 17q21.31
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2012]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004063	hsa-miR-7-5p	Microarray, Microarray;Other	19073608
MIRT004063	hsa-miR-7-5p	GFP reporter assay	23762407
MIRT004063	hsa-miR-7-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR	24281003
MIRT004063	hsa-miR-7-5p	FACS, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24281414
MIRT020956	hsa-miR-155-5p	Proteomics	18668040
MIRT022991	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT030577	hsa-miR-24-3p	Microarray	19748357
MIRT031898	hsa-miR-16-5p	Proteomics	18668040
MIRT031898	hsa-miR-16-5p	CLASH	23622248
MIRT032477	hsa-let-7b-5p	Proteomics	18668040
MIRT032477	hsa-let-7b-5p	CLASH	23622248
MIRT042151	hsa-miR-484	CLASH	23622248
MIRT043211	hsa-miR-324-5p	CLASH	23622248
MIRT043211	hsa-miR-324-5p	PAR-CLIP	26701625
MIRT043475	hsa-miR-331-3p	CLASH	23622248
MIRT077242	hsa-miR-583	PAR-CLIP	20371350
MIRT251100	hsa-miR-548au-3p	HITS-CLIP	19536157
MIRT287286	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT287289	hsa-miR-3117-5p	PAR-CLIP	20371350
MIRT287291	hsa-miR-4311	PAR-CLIP	20371350
MIRT375623	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT375624	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT470135	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT470136	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT470137	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT470138	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT470139	hsa-miR-5698	PAR-CLIP	23592263
MIRT470140	hsa-miR-3175	PAR-CLIP	23592263
MIRT470141	hsa-miR-8085	PAR-CLIP	23592263
MIRT470142	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT470143	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT470144	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT470145	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT470146	hsa-miR-4644	PAR-CLIP	23592263
MIRT470147	hsa-miR-4306	PAR-CLIP	23592263
MIRT470148	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT470149	hsa-miR-6133	PAR-CLIP	23592263
MIRT470150	hsa-miR-6130	PAR-CLIP	23592263
MIRT470151	hsa-miR-6129	PAR-CLIP	23592263
MIRT470152	hsa-miR-6127	PAR-CLIP	23592263
MIRT470153	hsa-miR-4510	PAR-CLIP	23592263
MIRT470154	hsa-miR-4419a	PAR-CLIP	23592263
MIRT470155	hsa-miR-570-3p	PAR-CLIP	23592263
MIRT470156	hsa-miR-4459	PAR-CLIP	23592263
MIRT470157	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT470158	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT470159	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT470160	hsa-miR-4779	PAR-CLIP	23592263
MIRT470161	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT564118	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT564119	hsa-miR-5692a	PAR-CLIP	20371350
MIRT564120	hsa-miR-1276	PAR-CLIP	20371350
MIRT711281	hsa-miR-7156-5p	HITS-CLIP	19536157
MIRT711282	hsa-miR-4273	HITS-CLIP	19536157
MIRT711283	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT711284	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT711285	hsa-miR-2117	HITS-CLIP	19536157
MIRT711286	hsa-miR-26b-3p	HITS-CLIP	19536157
MIRT711287	hsa-miR-6861-5p	HITS-CLIP	19536157
MIRT711288	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT711289	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT711290	hsa-miR-6742-3p	HITS-CLIP	19536157
MIRT711291	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT711292	hsa-miR-4292	HITS-CLIP	19536157
MIRT711293	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT711294	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT711295	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT711296	hsa-miR-6750-3p	HITS-CLIP	19536157
MIRT724085	hsa-miR-425-3p	HITS-CLIP	19536157
MIRT724086	hsa-miR-1206	HITS-CLIP	19536157
MIRT724087	hsa-miR-503-3p	HITS-CLIP	19536157
MIRT724088	hsa-miR-34c-3p	HITS-CLIP	19536157
MIRT726845	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT726846	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT726847	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT736891	hsa-miR-1273h-5p	PAR-CLIP	26701625
MIRT737383	hsa-miR-1322	PAR-CLIP	26701625
MIRT737560	hsa-miR-139-5p	PAR-CLIP	26701625
MIRT739781	hsa-miR-30b-3p	PAR-CLIP	26701625
MIRT739834	hsa-miR-30c-1-3p	PAR-CLIP	26701625
MIRT739877	hsa-miR-30c-2-3p	PAR-CLIP	26701625
MIRT741997	hsa-miR-3662	PAR-CLIP	26701625
MIRT742283	hsa-miR-3689a-3p	PAR-CLIP	26701625
MIRT742353	hsa-miR-3689b-3p	PAR-CLIP	26701625
MIRT742423	hsa-miR-3689c	PAR-CLIP	26701625
MIRT746949	hsa-miR-4684-5p	PAR-CLIP	26701625
MIRT750678	hsa-miR-548c-3p	PAR-CLIP	26701625
MIRT755525	hsa-miR-6779-5p	PAR-CLIP	26701625
MIRT755598	hsa-miR-6780a-5p	PAR-CLIP	26701625
MIRT755986	hsa-miR-6788-5p	PAR-CLIP	26701625
MIRT760413	hsa-miR-887-5p	PAR-CLIP	26701625

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0002039	Function	P53 binding	IDA	18309296
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	12970408, 16189514, 16439211, 16713569, 18309296, 20580715, 21516116, 22190034, 24722188, 25416956, 26871637, 27107012, 29934401, 32296183, 32703419, 32814053
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007049	Process	Cell cycle	IEA
GO:0008537	Component	Proteasome activator complex	IEA
GO:0010950	Process	Positive regulation of endopeptidase activity	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016032	Process	Viral process	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042802	Function	Identical protein binding	IPI	16169070, 16189514, 25416956, 27107012, 32296183
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061133	Function	Endopeptidase activator activity	IBA	21873635
GO:0061133	Function	Endopeptidase activator activity	IDA	18309296
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IBA	21873635
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IDA	18309296
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:0097371	Function	MDM2/MDM4 family protein binding	IDA	18309296
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IBA	21873635
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IDA	18309296

Other IDs

• MIM: 605129
• HGNC: 9570
• e!Ensembl: ENSG00000131467

Protein

• UniProt ID: P61289
• Protein name: Proteasome activator complex subunit 3 (11S regulator complex subunit gamma) (REG-gamma) (Activator of multicatalytic protease subunit 3) (Ki nuclear autoantigen) (Proteasome activator 28 subunit gamma) (PA28g) (PA28gamma)
• Protein function: Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of p53/TP53, limiting its accumulation and resulting in inhibited apoptosis after DNA damage. May also be involved in cell cycle regulation. Mediates CCAR2 and CHEK2-dependent SIRT1 inhibition (PubMed:25361978).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02251	PA28_alpha	9 → 69	Proteasome activator pa28 alpha subunit	Family
  PF02252	PA28_beta	108 → 252	Proteasome activator pa28 beta subunit	Family

• Sequence:

  MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHS
  DMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIE
  KVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQIS
  RYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIE
  KIKRPRSSNAETLY

• Sequence length: 254