PSMD9 (proteasome 26S subunit, non-ATPase 9)

Gene

• Entrez ID: 5715
• Gene name: Proteasome 26S subunit, non-ATPase 9
• Gene symbol: PSMD9
• Synonyms: Rpn4, p27
• Chromosome: 12
• Chromosome location: 12q24.31
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, May 2012]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020196	hsa-miR-130b-3p	Sequencing	20371350
MIRT021122	hsa-miR-186-5p	Sequencing	20371350
MIRT025995	hsa-miR-148a-3p	Sequencing	20371350
MIRT031151	hsa-miR-19b-3p	Sequencing	20371350
MIRT032262	hsa-let-7b-5p	Proteomics	18668040
MIRT682690	hsa-miR-1273g-3p	HITS-CLIP	23706177
MIRT682691	hsa-miR-1273a	HITS-CLIP	23706177
MIRT682692	hsa-miR-6736-5p	HITS-CLIP	23706177
MIRT682693	hsa-miR-4701-3p	HITS-CLIP	23706177
MIRT682694	hsa-miR-1262	HITS-CLIP	23706177
MIRT682695	hsa-miR-7703	HITS-CLIP	23706177
MIRT682696	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT682697	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT682698	hsa-miR-4504	HITS-CLIP	23706177
MIRT682699	hsa-miR-661	HITS-CLIP	23706177
MIRT682700	hsa-miR-6776-5p	HITS-CLIP	23706177
MIRT682701	hsa-miR-4793-3p	HITS-CLIP	23706177
MIRT682702	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT682703	hsa-miR-6742-3p	HITS-CLIP	23706177
MIRT682704	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT682705	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT732931	hsa-miR-21-5p	Flow, qRT-PCR, Western blot	26500453
MIRT733813	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28120918

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0003713	Function	Transcription coactivator activity	ISS	10567574
GO:0005515	Function	Protein binding	IPI	16189514, 19490896, 21516116, 25009770, 25416956, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	ISS	10567574
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	NAS	9653651
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	NAS	9653651
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IDA	19490896
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0032024	Process	Positive regulation of insulin secretion	ISS	10567574
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043425	Function	BHLH transcription factor binding	ISS	10567574
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	ISS	10567574, 16293776
GO:0046676	Process	Negative regulation of insulin secretion	ISS	16099819
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070682	Process	Proteasome regulatory particle assembly	IBA	21873635
GO:0070682	Process	Proteasome regulatory particle assembly	IMP	19490896
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

Other IDs

• MIM: 603146
• HGNC: 9567
• e!Ensembl: ENSG00000110801

Protein

• UniProt ID: O00233
• Protein name: 26S proteasome non-ATPase regulatory subunit 9 (26S proteasome regulatory subunit p27)
• Protein function: Acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700/19S regulatory complex (RC). During the base subcomplex assembly is part of an intermediate PSMD9:PSMC6:PSMC3 module, also known as modulator trimer complex; PSMD9 is released during the further base assembly process.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18265	Nas2_N	23 → 102	Nas2 N_terminal domain	Domain
  PF17820	PDZ_6	138 → 194	PDZ domain	Domain

• Sequence:

  MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCE
  GYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAM
  SRKLGQSESQGPPRAFAKVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIGSVV
  QHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGCNIIPLQR

• Sequence length: 223