PSMD7 (proteasome 26S subunit, non-ATPase 7)

Gene

• Entrez ID: 5713
• Gene name: Proteasome 26S subunit, non-ATPase 7
• Gene symbol: PSMD7
• Synonyms: MOV34, P40, Rpn8, S12
• Chromosome: 16
• Chromosome location: 16q23.1
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 17. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029210	hsa-miR-26b-5p	Microarray	19088304
MIRT043500	hsa-miR-331-3p	CLASH	23622248
MIRT046509	hsa-miR-15b-5p	CLASH	23622248
MIRT075438	hsa-miR-30a-5p	PAR-CLIP	24398324
MIRT075438	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT075438	hsa-miR-30a-5p	PAR-CLIP	20371350
MIRT075439	hsa-miR-30c-5p	PAR-CLIP	24398324
MIRT075439	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT075439	hsa-miR-30c-5p	PAR-CLIP	20371350
MIRT075440	hsa-miR-30d-5p	PAR-CLIP	24398324
MIRT075440	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT075440	hsa-miR-30d-5p	PAR-CLIP	20371350
MIRT075441	hsa-miR-30b-5p	PAR-CLIP	24398324
MIRT075441	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT075441	hsa-miR-30b-5p	PAR-CLIP	20371350
MIRT075442	hsa-miR-30e-5p	PAR-CLIP	24398324
MIRT075442	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT075442	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT075443	hsa-miR-338-5p	PAR-CLIP	24398324
MIRT075443	hsa-miR-338-5p	PAR-CLIP	21572407
MIRT075443	hsa-miR-338-5p	PAR-CLIP	20371350
MIRT075444	hsa-miR-570-5p	PAR-CLIP	24398324
MIRT075444	hsa-miR-570-5p	PAR-CLIP	21572407
MIRT075444	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT075445	hsa-miR-1287-5p	PAR-CLIP	24398324
MIRT075445	hsa-miR-1287-5p	PAR-CLIP	21572407
MIRT075445	hsa-miR-1287-5p	PAR-CLIP	20371350
MIRT075446	hsa-miR-1277-5p	PAR-CLIP	24398324
MIRT075446	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT075446	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT075447	hsa-miR-548ag	PAR-CLIP	24398324
MIRT075447	hsa-miR-548ag	PAR-CLIP	21572407
MIRT075447	hsa-miR-548ag	PAR-CLIP	20371350
MIRT075449	hsa-miR-548ai	PAR-CLIP	24398324
MIRT075449	hsa-miR-548ai	PAR-CLIP	21572407
MIRT075449	hsa-miR-548ai	PAR-CLIP	20371350
MIRT075450	hsa-miR-4487	PAR-CLIP	24398324
MIRT075450	hsa-miR-4487	PAR-CLIP	21572407
MIRT075450	hsa-miR-4487	PAR-CLIP	20371350
MIRT075451	hsa-miR-6126	PAR-CLIP	24398324
MIRT075451	hsa-miR-6126	PAR-CLIP	21572407
MIRT075451	hsa-miR-6126	PAR-CLIP	20371350
MIRT075452	hsa-miR-6864-5p	PAR-CLIP	24398324
MIRT075452	hsa-miR-6864-5p	PAR-CLIP	21572407
MIRT075452	hsa-miR-6864-5p	PAR-CLIP	20371350
MIRT075453	hsa-miR-6874-5p	PAR-CLIP	24398324
MIRT075453	hsa-miR-6874-5p	PAR-CLIP	21572407
MIRT075453	hsa-miR-6874-5p	PAR-CLIP	20371350
MIRT075454	hsa-miR-548ba	PAR-CLIP	24398324
MIRT075454	hsa-miR-548ba	PAR-CLIP	21572407
MIRT075454	hsa-miR-548ba	PAR-CLIP	20371350
MIRT075455	hsa-miR-8076	PAR-CLIP	24398324
MIRT075455	hsa-miR-8076	PAR-CLIP	21572407
MIRT075455	hsa-miR-8076	PAR-CLIP	20371350
MIRT501481	hsa-miR-6500-5p	PAR-CLIP	24398324
MIRT501481	hsa-miR-6500-5p	PAR-CLIP	21572407
MIRT501481	hsa-miR-6500-5p	PAR-CLIP	20371350
MIRT501482	hsa-miR-4633-3p	PAR-CLIP	24398324
MIRT501482	hsa-miR-4633-3p	PAR-CLIP	21572407
MIRT501482	hsa-miR-4633-3p	PAR-CLIP	20371350
MIRT501483	hsa-miR-493-3p	PAR-CLIP	24398324
MIRT501483	hsa-miR-493-3p	PAR-CLIP	21572407
MIRT501483	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT501484	hsa-miR-4802-5p	PAR-CLIP	24398324
MIRT501484	hsa-miR-4802-5p	PAR-CLIP	21572407
MIRT501484	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT501485	hsa-miR-6514-5p	PAR-CLIP	24398324
MIRT501485	hsa-miR-6514-5p	PAR-CLIP	21572407
MIRT501485	hsa-miR-6514-5p	PAR-CLIP	20371350
MIRT555178	hsa-miR-5003-5p	PAR-CLIP	21572407

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IBA	21873635
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	19615732, 22078707, 25416956, 25959826, 26496610, 28514442, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	IEA
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008237	Function	Metallopeptidase activity	IKR	17559875
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016579	Process	Protein deubiquitination	TAS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042803	Function	Protein homodimerization activity	IDA	17559875
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070122	Function	Isopeptidase activity	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 157970
• HGNC: 9565
• e!Ensembl: ENSG00000103035

Protein

• UniProt ID: P51665
• Protein name: 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit RPN8) (26S proteasome regulatory subunit S12) (Mov34 protein homolog) (Proteasome subunit p40)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair.
• PDB: 2O95, 2O96, 5GJQ, 5GJR, 5L4K, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 5VGZ, 5VHF, 5VHH, 5VHI, 5VHS, 6MSB, 6MSD, 6MSG, 6MSH, 6MSJ, 6MSK, 6WJD, 6WJN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01398	JAB	4 → 118	JAB1/Mov34/MPN/PAD-1 ubiquitin protease	Family
  PF13012	MitMem_reg	166 → 277	Maintenance of mitochondrial structure and function	Family

• Sequence:

  MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
  DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
  LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
  DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
  SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
  KEDKEKDKDKEKSDVKKEEKKEKK

• Sequence length: 324