PSMD6 (proteasome 26S subunit, non-ATPase 6)

Gene

• Entrez ID: 9861
• Gene name: Proteasome 26S subunit, non-ATPase 6
• Gene symbol: PSMD6
• Synonyms: Rpn7, S10, SGA-113M, p42A, p44S10
• Chromosome: 3
• Chromosome location: 3p14.1
• Summary: This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing res

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024707	hsa-miR-215-5p	Microarray	19074876
MIRT026186	hsa-miR-192-5p	Microarray	19074876
MIRT046979	hsa-miR-219a-5p	CLASH	23622248
MIRT043296	hsa-miR-331-3p	CLASH	23622248
MIRT038175	hsa-miR-423-5p	CLASH	23622248
MIRT1270616	hsa-miR-1285	CLIP-seq
MIRT1270617	hsa-miR-3121-5p	CLIP-seq
MIRT1270618	hsa-miR-3163	CLIP-seq
MIRT1270619	hsa-miR-3187-5p	CLIP-seq
MIRT1270620	hsa-miR-3611	CLIP-seq
MIRT1270621	hsa-miR-3661	CLIP-seq
MIRT1270622	hsa-miR-3675-3p	CLIP-seq
MIRT1270623	hsa-miR-4289	CLIP-seq
MIRT1270624	hsa-miR-4422	CLIP-seq
MIRT1270625	hsa-miR-4509	CLIP-seq
MIRT1270626	hsa-miR-4666-5p	CLIP-seq
MIRT1270627	hsa-miR-4744	CLIP-seq
MIRT1270628	hsa-miR-4789-5p	CLIP-seq
MIRT1270629	hsa-miR-4802-3p	CLIP-seq
MIRT1270630	hsa-miR-500a	CLIP-seq
MIRT1270631	hsa-miR-501-5p	CLIP-seq
MIRT1270632	hsa-miR-548c-3p	CLIP-seq
MIRT1270633	hsa-miR-612	CLIP-seq
MIRT1270634	hsa-miR-631	CLIP-seq
MIRT1270635	hsa-miR-944	CLIP-seq
MIRT1270616	hsa-miR-1285	CLIP-seq
MIRT1270618	hsa-miR-3163	CLIP-seq
MIRT1270619	hsa-miR-3187-5p	CLIP-seq
MIRT1270620	hsa-miR-3611	CLIP-seq
MIRT1270621	hsa-miR-3661	CLIP-seq
MIRT1270622	hsa-miR-3675-3p	CLIP-seq
MIRT1270623	hsa-miR-4289	CLIP-seq
MIRT1270628	hsa-miR-4789-5p	CLIP-seq
MIRT1270632	hsa-miR-548c-3p	CLIP-seq
MIRT1270633	hsa-miR-612	CLIP-seq
MIRT1270634	hsa-miR-631	CLIP-seq
MIRT1270635	hsa-miR-944	CLIP-seq
MIRT1270621	hsa-miR-3661	CLIP-seq
MIRT1270628	hsa-miR-4789-5p	CLIP-seq
MIRT1270634	hsa-miR-631	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BRCA2	Unknown	17563742

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	IBA	21873635
GO:0006508	Process	Proteolysis	NAS	10723133
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016887	Function	ATPase activity	NAS	10723133
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0030234	Function	Enzyme regulator activity	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 617857
• HGNC: 9564
• e!Ensembl: ENSG00000163636

Protein

• UniProt ID: Q15008
• Protein name: 26S proteasome non-ATPase regulatory subunit 6 (26S proteasome regulatory subunit RPN7) (26S proteasome regulatory subunit S10) (Breast cancer-associated protein SGA-113M) (Phosphonoformate immuno-associated protein 4) (Proteasome regulatory particle subu
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which
• PDB: 5GJQ, 5GJR, 5L4K, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 5VGZ, 5VHF, 5VHH, 5VHI, 5VHS, 6MSB, 6MSD, 6MSG, 6MSH, 6MSJ, 6MSK, 6WJD, 6WJN, 7QXN, 7QXP, 7QXU, 7QXW, 7QXX, 7QY7, 7QYA, 7QYB, 7W37, 7W38, 7W39, 7W3A, 7W3B, 7W3C, 7W3F, 7W3G, 7W3H, 7W3I, 7W3J, 7W3K, 7W3M, 8CVT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10602	RPN7	66 → 239	26S proteasome subunit RPN7	Family
  PF01399	PCI	254 → 358	PCI domain	Domain

• Sequence:

  MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKS
  LDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGA
  LTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRL
  KVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKV
  IKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMR
  IHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPD
  SKNWQYQETIKKGDLLLNRVQKLSRVINM

• Sequence length: 389