PSMD4 (proteasome 26S subunit ubiquitin receptor, non-ATPase 4)

Gene

• Entrez ID: 5710
• Gene name: Proteasome 26S subunit ubiquitin receptor, non-ATPase 4
• Gene symbol: PSMD4
• Synonyms: AF, AF-1, ASF, MCB1, Rpn10, S5A, pUB-R5
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT048850	hsa-miR-93-5p	CLASH	23622248
MIRT046856	hsa-miR-221-3p	CLASH	23622248
MIRT044963	hsa-miR-186-5p	CLASH	23622248
MIRT043083	hsa-miR-324-5p	CLASH	23622248
MIRT043083	hsa-miR-324-5p	CLASH	23622248
MIRT037698	hsa-miR-744-5p	CLASH	23622248
MIRT1270537	hsa-miR-1470	CLIP-seq
MIRT1270538	hsa-miR-1973	CLIP-seq
MIRT1270539	hsa-miR-2115	CLIP-seq
MIRT1270540	hsa-miR-3925-3p	CLIP-seq
MIRT1270541	hsa-miR-409-5p	CLIP-seq
MIRT1270542	hsa-miR-4446-5p	CLIP-seq
MIRT1270543	hsa-miR-4667-3p	CLIP-seq
MIRT1270544	hsa-miR-4755-5p	CLIP-seq
MIRT1270545	hsa-miR-4771	CLIP-seq
MIRT1270546	hsa-miR-512-5p	CLIP-seq
MIRT1270547	hsa-miR-516a-3p	CLIP-seq
MIRT1270548	hsa-miR-642a	CLIP-seq
MIRT2079505	hsa-miR-3929	CLIP-seq
MIRT1270541	hsa-miR-409-5p	CLIP-seq
MIRT2079506	hsa-miR-4419b	CLIP-seq
MIRT2079507	hsa-miR-4478	CLIP-seq
MIRT2079508	hsa-miR-4480	CLIP-seq
MIRT2079505	hsa-miR-3929	CLIP-seq
MIRT1270541	hsa-miR-409-5p	CLIP-seq
MIRT2079506	hsa-miR-4419b	CLIP-seq
MIRT2079507	hsa-miR-4478	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	10488153, 11146632, 15147878, 16990800, 17082820, 17139257, 17500595, 17662948, 18922472, 19490896, 19615732, 19796170, 19798103, 20059542, 20195357, 24811749, 25036637, 26496610, 28514442, 29290612, 29426014, 29997244, 31467278, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IBA	21873635
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042802	Function	Identical protein binding	IPI	16990800, 19931242
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043248	Process	Proteasome assembly	IBA	21873635
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

Other IDs

• MIM: 601648
• HGNC: 9561
• e!Ensembl: ENSG00000159352

Protein

• UniProt ID: P55036
• Protein name: 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which
• PDB: 1P9C, 1P9D, 1UEL, 1YX4, 1YX5, 1YX6, 2KDE, 2KDF, 5GJQ, 5GJR, 5L4K, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 5VGZ, 5VHF, 5VHH, 5VHI, 5VHS, 6MSB, 6MSD, 6MSE, 6MSG, 6MSH, 6MSJ, 6MSK, 6MUN, 6U19, 6WJD, 6WJN, 7QXN, 7QXP, 7QXU, 7QXW, 7QXX, 7QY7, 7QYA, 7QYB, 7W37, 7W38, 7W39
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13519	VWA_2	6 → 116	von Willebrand factor type A domain	Domain
  PF02809	UIM	211 → 227	Ubiquitin interaction motif	Motif
  PF02809	UIM	282 → 298	Ubiquitin interaction motif	Motif

• Sequence:

  MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEV
  LTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDN
  EKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLA
  DALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAA
  ASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEF
  GQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLA
  SQATKDGKKDKKEEDKK

• Sequence length: 377