PSMD3 (proteasome 26S subunit, non-ATPase 3)

Gene

• Entrez ID: 5709
• Gene name: Proteasome 26S subunit, non-ATPase 3
• Gene symbol: PSMD3
• Synonyms: P58, RPN3, S3, TSTA2
• Chromosome: 17
• Chromosome location: 17q21.1
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the proteasome subunit S3 family that functions as one of the non-ATPase subunits of the 19S regulator lid. Single nucleotide polymorphisms in this gene are associated with neutrophil count. [provided by RefSeq, Jul 2012]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT036722	hsa-miR-760	CLASH	23622248
MIRT039148	hsa-miR-769-5p	CLASH	23622248
MIRT040625	hsa-miR-92b-3p	CLASH	23622248
MIRT044009	hsa-miR-378a-5p	CLASH	23622248
MIRT045113	hsa-miR-186-5p	CLASH	23622248
MIRT049247	hsa-miR-92a-3p	CLASH	23622248
MIRT490773	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT490774	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT490775	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT490776	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT490777	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT490778	hsa-miR-3175	PAR-CLIP	23592263
MIRT490779	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT490780	hsa-miR-5787	PAR-CLIP	23592263
MIRT490781	hsa-miR-4505	PAR-CLIP	23592263
MIRT490782	hsa-miR-765	PAR-CLIP	23592263
MIRT490783	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT490784	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT490785	hsa-miR-8089	PAR-CLIP	23592263
MIRT490786	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT490787	hsa-miR-181d-3p	PAR-CLIP	23592263
MIRT490788	hsa-miR-224-5p	PAR-CLIP	23592263
MIRT490789	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT490790	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490791	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490792	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490793	hsa-miR-3153	PAR-CLIP	23592263
MIRT490794	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT490795	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490796	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT490797	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT490798	hsa-miR-6859-3p	PAR-CLIP	23592263
MIRT490799	hsa-miR-612	PAR-CLIP	23592263
MIRT490800	hsa-miR-6860	PAR-CLIP	23592263
MIRT490801	hsa-miR-5189-5p	PAR-CLIP	23592263
MIRT490802	hsa-miR-3187-5p	PAR-CLIP	23592263
MIRT490803	hsa-miR-1285-3p	PAR-CLIP	23592263
MIRT490804	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT490805	hsa-miR-4292	PAR-CLIP	23592263
MIRT490806	hsa-miR-6791-5p	PAR-CLIP	23592263
MIRT490807	hsa-miR-6814-5p	PAR-CLIP	23592263
MIRT490808	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490809	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT490810	hsa-miR-1276	PAR-CLIP	23592263

Transcription factors

Transcription factor	Regulation	Reference
BRCA2	Unknown	17563742

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	15147878, 25416956, 25814554, 25910212, 26030138, 31515488, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016579	Process	Protein deubiquitination	TAS
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0030234	Function	Enzyme regulator activity	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042176	Process	Regulation of protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 617676
• HGNC: 9560
• e!Ensembl: ENSG00000108344

Protein

• UniProt ID: O43242
• Protein name: 26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit RPN3) (26S proteasome regulatory subunit S3) (Proteasome subunit p58)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair.
• PDB: 5GJQ, 5GJR, 5L4K, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 5VGZ, 5VHF, 5VHH, 5VHI, 5VHS, 6MSB, 6MSD, 6MSE, 6MSG, 6MSH, 6MSJ, 6MSK, 6WJD, 6WJN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01399	PCI	358 → 462	PCI domain	Domain
  PF08375	Rpn3_C	465 → 532	Proteasome regulatory subunit C-terminal	Family

• Sequence:

  MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAA
  EHSQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGF
  FTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKR
  YKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATL
  RHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQL
  EYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPY
  FLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLA
  DIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRI
  SFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP

• Sequence length: 534