PSMD2 (proteasome 26S subunit ubiquitin receptor, non-ATPase 2)

Gene

• Entrez ID: 5708
• Gene name: Proteasome 26S subunit ubiquitin receptor, non-ATPase 2
• Gene symbol: PSMD2
• Synonyms: P97, RPN1, S2, TRAP2
• Chromosome: 3
• Chromosome location: 3q27.1
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004400	hsa-miR-200a-3p	Microarray, Northern blot	16331254
MIRT051506	hsa-let-7e-5p	CLASH	23622248
MIRT050480	hsa-miR-20a-5p	CLASH	23622248
MIRT049452	hsa-miR-92a-3p	CLASH	23622248
MIRT045290	hsa-miR-186-5p	CLASH	23622248
MIRT044106	hsa-miR-361-5p	CLASH	23622248
MIRT043381	hsa-miR-331-3p	CLASH	23622248
MIRT043028	hsa-miR-324-5p	CLASH	23622248
MIRT042898	hsa-miR-324-3p	CLASH	23622248
MIRT039985	hsa-miR-615-3p	CLASH	23622248
MIRT039985	hsa-miR-615-3p	CLASH	23622248
MIRT1270502	hsa-miR-1264	CLIP-seq
MIRT1270503	hsa-miR-1273	CLIP-seq
MIRT1270504	hsa-miR-1273c	CLIP-seq
MIRT1270505	hsa-miR-1276	CLIP-seq
MIRT1270506	hsa-miR-2278	CLIP-seq
MIRT1270507	hsa-miR-4459	CLIP-seq
MIRT1270508	hsa-miR-4695-5p	CLIP-seq
MIRT1270509	hsa-miR-4722-5p	CLIP-seq
MIRT1270510	hsa-miR-4797-3p	CLIP-seq
MIRT1270511	hsa-miR-495	CLIP-seq
MIRT1270512	hsa-miR-548n	CLIP-seq
MIRT1270513	hsa-miR-548t	CLIP-seq
MIRT1270514	hsa-miR-802	CLIP-seq
MIRT2079493	hsa-miR-1207-3p	CLIP-seq
MIRT1270503	hsa-miR-1273	CLIP-seq
MIRT1270504	hsa-miR-1273c	CLIP-seq
MIRT2079494	hsa-miR-370	CLIP-seq
MIRT1270507	hsa-miR-4459	CLIP-seq
MIRT1270508	hsa-miR-4695-5p	CLIP-seq
MIRT1270509	hsa-miR-4722-5p	CLIP-seq
MIRT2305783	hsa-miR-1184	CLIP-seq
MIRT2305784	hsa-miR-1205	CLIP-seq
MIRT1270503	hsa-miR-1273	CLIP-seq
MIRT1270504	hsa-miR-1273c	CLIP-seq
MIRT1270505	hsa-miR-1276	CLIP-seq
MIRT1270506	hsa-miR-2278	CLIP-seq
MIRT2305785	hsa-miR-3158-5p	CLIP-seq
MIRT2305786	hsa-miR-361-3p	CLIP-seq
MIRT2305787	hsa-miR-3679-3p	CLIP-seq
MIRT1270507	hsa-miR-4459	CLIP-seq
MIRT1270508	hsa-miR-4695-5p	CLIP-seq
MIRT1270509	hsa-miR-4722-5p	CLIP-seq
MIRT1270510	hsa-miR-4797-3p	CLIP-seq
MIRT1270511	hsa-miR-495	CLIP-seq
MIRT1270514	hsa-miR-802	CLIP-seq
MIRT1270510	hsa-miR-4797-3p	CLIP-seq
MIRT1270514	hsa-miR-802	CLIP-seq
MIRT1270510	hsa-miR-4797-3p	CLIP-seq
MIRT1270514	hsa-miR-802	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	11278995, 16189514, 16763564, 16990800, 18457437, 18922472, 19060904, 19490896, 19615732, 22901813, 25036637, 25416956, 26496610, 28514442, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	TAS	8774743
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016579	Process	Protein deubiquitination	TAS
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0030234	Function	Enzyme regulator activity	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034515	Component	Proteasome storage granule	IBA	21873635
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042176	Process	Regulation of protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 606223
• HGNC: 9559
• e!Ensembl: ENSG00000175166

Protein

• UniProt ID: Q13200
• Protein name: 26S proteasome non-ATPase regulatory subunit 2 (26S proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Protein 55.11) (Tumor necrosis factor type 1 receptor-associated protein 2)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which
• PDB: 5GJQ, 5GJR, 5L4K, 5LN3, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 5VHF, 5VHH, 5VHI, 5VHJ, 5VHM, 5VHN, 5VHO, 5VHP, 5VHQ, 5VHR, 5VHS, 6MSB, 6MSD, 6MSG, 6MSH, 6MSJ, 6MSK, 6WJD, 6WJN, 7QXN, 7QXP, 7QXU, 7QXW, 7QXX, 7QY7, 7QYA, 7QYB, 7UIH, 7UJD, 7W37, 7W38, 7W39, 7W3A, 7W3B, 7W3C, 7W3F
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17781	RPN1_RPN2_N	56 → 354	RPN1/RPN2 N-terminal domain	Domain
  PF01851	PC_rep	443 → 479	Proteasome/cyclosome repeat	Repeat
  PF01851	PC_rep	480 → 514	Proteasome/cyclosome repeat	Repeat
  PF18051	RPN1_C	853 → 906	26S proteasome non-ATPase regulatory subunit RPN1 C-terminal	Domain

• Sequence:

  MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLV
  ERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKR
  FAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQ
  REPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYV
  PEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGR
  HGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGG
  SGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLW
  DVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLG
  SIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQ
  TIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAY
  AGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALI
  AMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPE
  VSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCP
  YHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPL
  PVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVIL
  RKNPNYDL

• Sequence length: 908