PSMD14 (proteasome 26S subunit, non-ATPase 14)

Gene

• Entrez ID: 10213
• Gene name: Proteasome 26S subunit, non-ATPase 14
• Gene symbol: PSMD14
• Synonyms: PAD1, POH1, RPN11
• Chromosome: 2
• Chromosome location: 2q24.2
• Summary: This gene encodes a component of the 26S proteasome. The 26S proteasome is a large multiprotein complex that catalyzes the degradation of ubiquitinated intracellular proteins. The encoded protein is a component of the 19S regulatory cap complex of the 26S

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT046307	hsa-miR-23b-3p	CLASH	23622248
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270461	hsa-miR-186	CLIP-seq
MIRT1270462	hsa-miR-2276	CLIP-seq
MIRT1270463	hsa-miR-2355-3p	CLIP-seq
MIRT1270464	hsa-miR-25	CLIP-seq
MIRT1270465	hsa-miR-302f	CLIP-seq
MIRT1270466	hsa-miR-3125	CLIP-seq
MIRT1270467	hsa-miR-3133	CLIP-seq
MIRT1270468	hsa-miR-3171	CLIP-seq
MIRT1270469	hsa-miR-32	CLIP-seq
MIRT1270470	hsa-miR-363	CLIP-seq
MIRT1270471	hsa-miR-3667-5p	CLIP-seq
MIRT1270472	hsa-miR-367	CLIP-seq
MIRT1270473	hsa-miR-3914	CLIP-seq
MIRT1270474	hsa-miR-3916	CLIP-seq
MIRT1270475	hsa-miR-4257	CLIP-seq
MIRT1270476	hsa-miR-4282	CLIP-seq
MIRT1270477	hsa-miR-4436b-5p	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT1270479	hsa-miR-4646-3p	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270481	hsa-miR-4694-5p	CLIP-seq
MIRT1270482	hsa-miR-4725-5p	CLIP-seq
MIRT1270483	hsa-miR-4732-3p	CLIP-seq
MIRT1270484	hsa-miR-4744	CLIP-seq
MIRT1270485	hsa-miR-4772-3p	CLIP-seq
MIRT1270486	hsa-miR-4780	CLIP-seq
MIRT1270487	hsa-miR-4789-5p	CLIP-seq
MIRT1270488	hsa-miR-493	CLIP-seq
MIRT1270489	hsa-miR-495	CLIP-seq
MIRT1270490	hsa-miR-504	CLIP-seq
MIRT1270491	hsa-miR-512-3p	CLIP-seq
MIRT1270492	hsa-miR-518a-5p	CLIP-seq
MIRT1270493	hsa-miR-527	CLIP-seq
MIRT1270494	hsa-miR-568	CLIP-seq
MIRT1270495	hsa-miR-582-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270497	hsa-miR-623	CLIP-seq
MIRT1270498	hsa-miR-630	CLIP-seq
MIRT1270499	hsa-miR-664	CLIP-seq
MIRT1270500	hsa-miR-92a	CLIP-seq
MIRT1270501	hsa-miR-92b	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270466	hsa-miR-3125	CLIP-seq
MIRT2603089	hsa-miR-3672	CLIP-seq
MIRT2603090	hsa-miR-3910	CLIP-seq
MIRT1270473	hsa-miR-3914	CLIP-seq
MIRT1270474	hsa-miR-3916	CLIP-seq
MIRT1270475	hsa-miR-4257	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT2603091	hsa-miR-4493	CLIP-seq
MIRT2603092	hsa-miR-4499	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270481	hsa-miR-4694-5p	CLIP-seq
MIRT1270486	hsa-miR-4780	CLIP-seq
MIRT1270487	hsa-miR-4789-5p	CLIP-seq
MIRT1270488	hsa-miR-493	CLIP-seq
MIRT1270491	hsa-miR-512-3p	CLIP-seq
MIRT1270495	hsa-miR-582-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270497	hsa-miR-623	CLIP-seq
MIRT2603093	hsa-miR-633	CLIP-seq
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270466	hsa-miR-3125	CLIP-seq
MIRT2603089	hsa-miR-3672	CLIP-seq
MIRT2603090	hsa-miR-3910	CLIP-seq
MIRT1270473	hsa-miR-3914	CLIP-seq
MIRT1270474	hsa-miR-3916	CLIP-seq
MIRT1270475	hsa-miR-4257	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT2603091	hsa-miR-4493	CLIP-seq
MIRT2603092	hsa-miR-4499	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270481	hsa-miR-4694-5p	CLIP-seq
MIRT1270486	hsa-miR-4780	CLIP-seq
MIRT1270487	hsa-miR-4789-5p	CLIP-seq
MIRT1270488	hsa-miR-493	CLIP-seq
MIRT1270491	hsa-miR-512-3p	CLIP-seq
MIRT1270495	hsa-miR-582-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270497	hsa-miR-623	CLIP-seq
MIRT2603093	hsa-miR-633	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	TAS	19214193
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	22909820
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004843	Function	Thiol-dependent ubiquitin-specific protease activity	IBA	21873635
GO:0004843	Function	Thiol-dependent ubiquitin-specific protease activity	IMP	22909820
GO:0004843	Function	Thiol-dependent ubiquitin-specific protease activity	TAS	19214193
GO:0005515	Function	Protein binding	IPI	19615732, 25416956, 25959826, 26496610, 28514442, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IMP	22909820
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	9374539
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008237	Function	Metallopeptidase activity	IBA	21873635
GO:0008237	Function	Metallopeptidase activity	TAS	19214193
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA	21873635
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IMP	22909820
GO:0010950	Process	Positive regulation of endopeptidase activity	IEA
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016579	Process	Protein deubiquitination	IBA	21873635
GO:0016579	Process	Protein deubiquitination	TAS
GO:0018215	Process	Protein phosphopantetheinylation	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0031597	Component	Cytosolic proteasome complex	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045471	Process	Response to ethanol	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061133	Function	Endopeptidase activator activity	IMP	18162577
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IMP	18162577
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0061578	Function	Lys63-specific deubiquitinase activity	TAS
GO:0070122	Function	Isopeptidase activity	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070536	Process	Protein K63-linked deubiquitination	IMP	22909820
GO:0070536	Process	Protein K63-linked deubiquitination	TAS	19214193
GO:0070628	Function	Proteasome binding	IBA	21873635
GO:0070628	Function	Proteasome binding	IDA	18162577
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 607173
• HGNC: 16889
• e!Ensembl: ENSG00000115233

Protein

• UniProt ID: O00487
• Protein name: 26S proteasome non-ATPase regulatory subunit 14 (EC 3.4.19.-) (26S proteasome regulatory subunit RPN11) (26S proteasome-associated PAD1 homolog 1)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which
• PDB: 5GJQ, 5GJR, 5L4K, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 5VGZ, 5VHF, 5VHH, 5VHI, 5VHS, 6MSB, 6MSD, 6MSE, 6MSG, 6MSH, 6MSJ, 6MSK, 6WJD, 6WJN, 7QXN, 7QXP, 7QXU, 7QXW, 7QXX, 7QY7, 7QYA, 7QYB, 7W37, 7W38, 7W39, 7W3A, 7W3B, 7W3C, 7W3F, 7W3G, 7W3H, 7W3I, 7W3J, 7W3K, 7W3M
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01398	JAB	26 → 139	JAB1/Mov34/MPN/PAD-1 ubiquitin protease	Family
  PF13012	MitMem_reg	173 → 307	Maintenance of mitochondrial structure and function	Family

• Sequence:

  MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
  FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
  WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
  LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
  NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
  AAMLDTVVFK

• Sequence length: 310