GediPNet logo

PSMD10 (proteasome 26S subunit, non-ATPase 10)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5716
Gene nameGene Name - the full gene name approved by the HGNC.
Proteasome 26S subunit, non-ATPase 10
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
PSMD10
SynonymsGene synonyms aliases
dJ889N15.2, p28, p28(GANK)
ChromosomeChromosome number
X
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq22.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in protein-protein interactions. Aberrant expression of this gene may paly a role in tumorigenesis. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20.[provided by RefSeq, Mar 2011]
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023306 hsa-miR-122-5p Proteomics 21750653
MIRT035545 hsa-miR-214-3p Luciferase reporter assay 23100276
MIRT036871 hsa-miR-877-3p CLASH 23622248
MIRT044545 hsa-miR-320a CLASH 23622248
MIRT438269 hsa-miR-605-5p Luciferase reporter assay, Western blot 25131931
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 16023600
GO:0000165 Process MAPK cascade TAS
GO:0000209 Process Protein polyubiquitination TAS
GO:0000502 Component Proteasome complex IDA 17323924
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway TAS
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID O75832
Protein name 26S proteasome non-ATPase regulatory subunit 10 (26S proteasome regulatory subunit p28) (Gankyrin) (p28(GANK))
Protein function Acts as a chaperone during the assembly of the 26S proteasome, specifically of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD10:PSMC4:PSMC5:PAAF1 module which probably assembles with a PSMD5:PSMC2:PSMC1:PSMD2 module. Independently of the proteasome, regulates EGF-induced AKT activation through inhibition of the RHOA/ROCK/PTEN pathway, leading to prolonged AKT activation. Plays an important role in RAS-induced tumorigenesis.; Acts as an proto-oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4. Facilitates binding of MDM2 to p53/TP53 and the mono- and polyubiquitination of p53/TP53 by MDM2 suggesting a function in targeting the TP53:MDM2 complex to the 26S proteasome. Involved in p53-independent apoptosis. Involved in regulation of NF-kappa-B by retaining it in the cytoplasm. Binds to the NF-kappa-B component RELA and accelerates its XPO1/CRM1-mediated nuclear export.
PDB 1QYM , 1TR4 , 1UOH , 4NIK , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2
8 103
Ankyrin repeats (3 copies)
Repeat
PF13637 Ank_4
40 93
Repeat
PF13637 Ank_4
73 126
Repeat
PF13637 Ank_4
139 184
Repeat
Sequence
MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLL
QLGVPVNDKDDA
GWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHE
IAVMLL
EGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLAC
DEER
VEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG
Sequence length 226
Interactions View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412