PSMC5 (proteasome 26S subunit, ATPase 5)

Gene

• Entrez ID: 5705
• Gene name: Proteasome 26S subunit, ATPase 5
• Gene symbol: PSMC5
• Synonyms: RPT6, S8, SUG-1, SUG1, TBP10, TRIP1, p45, p45/SUG
• Chromosome: 17
• Chromosome location: 17q23.3
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. In addition to participation in proteasome functions, this subunit may participate in transcriptional regulation since it has been shown to interact with the thyroid hormone receptor and retinoid X receptor-alpha. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT036390	hsa-miR-1229-3p	CLASH	23622248
MIRT041377	hsa-miR-193b-3p	CLASH	23622248
MIRT041740	hsa-miR-484	CLASH	23622248
MIRT043146	hsa-miR-324-5p	CLASH	23622248

Transcription factors

Transcription factor	Regulation	Reference
CIITA	Activation	22771340
CREBBP	Activation	22771340

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	9464850, 17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	9173976, 9927201, 16189514, 16763564, 16990800, 17693435, 19490896, 20178748, 21516116, 22078707, 22901813, 23032291, 23824326, 25416956, 26030138, 26496610, 28514442, 29636472, 29892012, 31515488, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	9927201
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	9927201
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	7870181
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008134	Function	Transcription factor binding	IDA	7870181
GO:0008134	Function	Transcription factor binding	IPI	9173976, 10816420
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016234	Component	Inclusion body	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016887	Function	ATPase activity	ISS	1429620
GO:0016887	Function	ATPase activity	TAS	9464850
GO:0017025	Function	TBP-class protein binding	IBA	21873635
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0031410	Component	Cytoplasmic vesicle	IDA	15885686
GO:0031531	Function	Thyrotropin-releasing hormone receptor binding	IPI	7870181
GO:0031595	Component	Nuclear proteasome complex	IBA	21873635
GO:0031597	Component	Cytosolic proteasome complex	IBA	21873635
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043069	Process	Negative regulation of programmed cell death	NAS	16432160
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	12110588
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	NAS	7870181
GO:0045899	Process	Positive regulation of RNA polymerase II transcription preinitiation complex assembly	IBA	21873635
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA	21873635
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090261	Process	Positive regulation of inclusion body assembly	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:0098794	Component	Postsynapse	IBA	21873635
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

Other IDs

• MIM: 601681
• HGNC: 9552
• e!Ensembl: ENSG00000087191

Protein

• UniProt ID: P62195
• Protein name: 26S proteasome regulatory subunit 8 (26S proteasome AAA-ATPase subunit RPT6) (Proteasome 26S subunit ATPase 5) (Proteasome subunit p45) (Thyroid hormone receptor-interacting protein 1) (TRIP1) (p45/SUG)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. PSMC5 belongs to the heterohexameric ring of AAA (ATPases associated with diverse cellular activities) proteins that unfolds ubiquitinated target proteins that are concurrently translocated into a proteolytic chamber and degraded into peptides.
• PDB: 2KRK, 3KW6, 5GJQ, 5GJR, 5L4G, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 5VGZ, 5VHF, 5VHH, 5VHI, 5VHJ, 5VHM, 5VHN, 5VHO, 5VHP, 5VHQ, 5VHR, 5VHS, 6MSB, 6MSD, 6MSG, 6MSH, 6MSJ, 6MSK, 6WJD, 6WJN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16450	Prot_ATP_ID_OB	73 → 128	Proteasomal ATPase OB C-terminal domain	Domain
  PF00004	AAA	186 → 319	ATPase family associated with various cellular activities (AAA)	Domain
  PF17862	AAA_lid_3	341 → 385	AAA+ lid domain	Domain

• Sequence:

  MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
  EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDS
  YTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGI
  AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
  HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
  LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
  GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK

• Sequence length: 406