PSMC5 (proteasome 26S subunit, ATPase 5)

Gene

• Entrez ID: 5705
• Gene name: Proteasome 26S subunit, ATPase 5
• Gene symbol: PSMC5
• Synonyms: RPT6, S8, SUG-1, SUG1, TBP10, TRIP1, p45, p45/SUG
• Chromosome: 17
• Chromosome location: 17q23.3
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043146	hsa-miR-324-5p	CLASH	23622248
MIRT041740	hsa-miR-484	CLASH	23622248
MIRT041377	hsa-miR-193b-3p	CLASH	23622248
MIRT036390	hsa-miR-1229-3p	CLASH	23622248

Transcription factors

Transcription factor	Regulation	Reference
CIITA	Activation	22771340
CREBBP	Activation	22771340

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	9464850, 17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	9173976, 9927201, 16189514, 16763564, 16990800, 17693435, 19490896, 20178748, 21516116, 22078707, 22901813, 23032291, 23824326, 25416956, 26030138, 26496610, 28514442, 29636472, 29892012, 31515488, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	9927201
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	9927201
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	7870181
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008134	Function	Transcription factor binding	IDA	7870181
GO:0008134	Function	Transcription factor binding	IPI	9173976, 10816420
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016234	Component	Inclusion body	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016887	Function	ATPase activity	ISS	1429620
GO:0016887	Function	ATPase activity	TAS	9464850
GO:0017025	Function	TBP-class protein binding	IBA	21873635
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0031410	Component	Cytoplasmic vesicle	IDA	15885686
GO:0031531	Function	Thyrotropin-releasing hormone receptor binding	IPI	7870181
GO:0031595	Component	Nuclear proteasome complex	IBA	21873635
GO:0031597	Component	Cytosolic proteasome complex	IBA	21873635
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043069	Process	Negative regulation of programmed cell death	NAS	16432160
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	12110588
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	NAS	7870181
GO:0045899	Process	Positive regulation of RNA polymerase II transcription preinitiation complex assembly	IBA	21873635
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA	21873635
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090261	Process	Positive regulation of inclusion body assembly	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:0098794	Component	Postsynapse	IBA	21873635
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

Other IDs

• MIM: 601681
• HGNC: 9552
• e!Ensembl: ENSG00000087191

Protein

• UniProt ID: P62195
• Protein name: 26S proteasome regulatory subunit 8 (26S proteasome AAA-ATPase subunit RPT6) (Proteasome 26S subunit ATPase 5) (Proteasome subunit p45) (Thyroid hormone receptor-interacting protein 1) (TRIP1) (p45/SUG)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which
• PDB: 2KRK, 3KW6, 5GJQ, 5GJR, 5L4G, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 5VGZ, 5VHF, 5VHH, 5VHI, 5VHJ, 5VHM, 5VHN, 5VHO, 5VHP, 5VHQ, 5VHR, 5VHS, 6MSB, 6MSD, 6MSG, 6MSH, 6MSJ, 6MSK, 6WJD, 6WJN, 7QXN, 7QXP, 7QXU, 7QXW, 7QXX, 7QY7, 7QYA, 7QYB, 7W37, 7W38, 7W39, 7W3A, 7W3B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16450	Prot_ATP_ID_OB	73 → 128	Proteasomal ATPase OB C-terminal domain	Domain
  PF00004	AAA	186 → 319	ATPase family associated with various cellular activities (AAA)	Domain
  PF17862	AAA_lid_3	341 → 385	AAA+ lid domain	Domain

• Sequence:

  MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
  EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDS
  YTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGI
  AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
  HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
  LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
  GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK

• Sequence length: 406