PSMC4 (proteasome 26S subunit, ATPase 4)

Gene

• Entrez ID: 5704
• Gene name: Proteasome 26S subunit, ATPase 4
• Gene symbol: PSMC4
• Synonyms: MIP224, RPT3, S6, TBP-7, TBP7
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the triple-A family of ATPases that is a component of the 19S regulatory subunit and plays a role in 26S proteasome assembly. The encoded protein interacts with gankyrin, a liver oncoprotein, and may also play a role in Parkinson`s disease through interactions with synphilin-1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029325	hsa-miR-26b-5p	Microarray	19088304
MIRT036915	hsa-miR-877-3p	CLASH	23622248
MIRT043323	hsa-miR-331-3p	CLASH	23622248
MIRT046684	hsa-miR-222-3p	CLASH	23622248
MIRT051335	hsa-miR-15a-5p	CLASH	23622248
MIRT697059	hsa-miR-665	HITS-CLIP	23313552
MIRT697060	hsa-miR-133a-3p	HITS-CLIP	23313552
MIRT697061	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT697062	hsa-miR-7977	HITS-CLIP	23313552
MIRT697063	hsa-miR-4281	HITS-CLIP	23313552
MIRT697064	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT697065	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT697066	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT697067	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT697068	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT697069	hsa-miR-1827	HITS-CLIP	23313552
MIRT697070	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT697071	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT697072	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT697073	hsa-miR-5690	HITS-CLIP	23313552
MIRT697074	hsa-miR-4478	HITS-CLIP	23313552
MIRT697075	hsa-miR-4419b	HITS-CLIP	23313552
MIRT697076	hsa-miR-3929	HITS-CLIP	23313552
MIRT697077	hsa-miR-940	HITS-CLIP	23313552
MIRT697078	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT697079	hsa-miR-6808-5p	HITS-CLIP	23313552

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	12525503, 16189514, 17292836, 19490896, 21988832, 22078707, 24338975, 25416956, 26496610, 29128334, 29636472, 29804830, 29892012, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	TAS	8603043
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016234	Component	Inclusion body	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016887	Function	ATPase activity	TAS	9473509
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0031597	Component	Cytosolic proteasome complex	IBA	21873635
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0036402	Function	Proteasome-activating ATPase activity	IEA
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045202	Component	Synapse	IBA	21873635
GO:0045899	Process	Positive regulation of RNA polymerase II transcription preinitiation complex assembly	IBA	21873635
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IEA
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

Other IDs

• MIM: 602707
• HGNC: 9551
• e!Ensembl: ENSG00000013275

Protein

• UniProt ID: P43686
• Protein name: 26S proteasome regulatory subunit 6B (26S proteasome AAA-ATPase subunit RPT3) (MB67-interacting protein) (MIP224) (Proteasome 26S subunit ATPase 4) (Tat-binding protein 7) (TBP-7)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. PSMC4 belongs to the heterohexameric ring of AAA (ATPases associated with diverse cellular activities) proteins that unfolds ubiquitinated target proteins that are concurrently translocated into a proteolytic chamber and degraded into peptides.
• PDB: 2DVW, 5GJQ, 5GJR, 5L4G, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 5VGZ, 5VHF, 5VHH, 5VHI, 5VHJ, 5VHM, 5VHN, 5VHO, 5VHP, 5VHQ, 5VHR, 5VHS, 6MSB, 6MSD, 6MSE, 6MSG, 6MSH, 6MSJ, 6MSK, 6WJD, 6WJN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16450	Prot_ATP_ID_OB	89 → 144	Proteasomal ATPase OB C-terminal domain	Domain
  PF00004	AAA	202 → 335	ATPase family associated with various cellular activities (AAA)	Domain
  PF17862	AAA_lid_3	357 → 401	AAA+ lid domain	Domain

• Sequence:

  MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEY
  IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTID
  RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREA
  VELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
  GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
  QNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDL
  EDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK

• Sequence length: 418