GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

PSMC2 (proteasome 26S subunit, ATPase 2)

Gene

5701

Proteasome 26S subunit, ATPase 2

PSMC2

MSS1, Nbla10058, RPT1, S7

7q22.1

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Show/Hide all(107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031892	hsa-miR-16-5p	Proteomics	18668040
MIRT041958	hsa-miR-484	CLASH	23622248
MIRT721125	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT721124	hsa-miR-5693	HITS-CLIP	19536157
MIRT721123	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT721122	hsa-miR-3161	HITS-CLIP	19536157
MIRT721121	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT721120	hsa-miR-599	HITS-CLIP	19536157
MIRT721125	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT721124	hsa-miR-5693	HITS-CLIP	19536157
MIRT721123	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT721122	hsa-miR-3161	HITS-CLIP	19536157
MIRT721121	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT721120	hsa-miR-599	HITS-CLIP	19536157
MIRT1270315	hsa-miR-127-5p	CLIP-seq
MIRT1270316	hsa-miR-1321	CLIP-seq
MIRT1270317	hsa-miR-144	CLIP-seq
MIRT1270318	hsa-miR-3175	CLIP-seq
MIRT1270319	hsa-miR-3606	CLIP-seq
MIRT1270320	hsa-miR-362-5p	CLIP-seq
MIRT1270321	hsa-miR-4419a	CLIP-seq
MIRT1270322	hsa-miR-4510	CLIP-seq
MIRT1270323	hsa-miR-4645-3p	CLIP-seq
MIRT1270324	hsa-miR-4709-5p	CLIP-seq
MIRT1270325	hsa-miR-4728-5p	CLIP-seq
MIRT1270326	hsa-miR-4739	CLIP-seq
MIRT1270327	hsa-miR-4756-5p	CLIP-seq
MIRT1270328	hsa-miR-4786-3p	CLIP-seq
MIRT1270329	hsa-miR-500b	CLIP-seq
MIRT1270330	hsa-miR-501-5p	CLIP-seq
MIRT1270331	hsa-miR-548n	CLIP-seq
MIRT1270332	hsa-miR-921	CLIP-seq
MIRT1270333	hsa-miR-1258	CLIP-seq
MIRT1270334	hsa-miR-219-2-3p	CLIP-seq
MIRT1270335	hsa-miR-2964a-3p	CLIP-seq
MIRT1270336	hsa-miR-3159	CLIP-seq
MIRT1270337	hsa-miR-3614-5p	CLIP-seq
MIRT1270338	hsa-miR-410	CLIP-seq
MIRT1270339	hsa-miR-4477a	CLIP-seq
MIRT1270340	hsa-miR-4704-3p	CLIP-seq
MIRT1270341	hsa-miR-4796-5p	CLIP-seq
MIRT1270342	hsa-miR-5096	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT1270344	hsa-miR-651	CLIP-seq
MIRT1270333	hsa-miR-1258	CLIP-seq
MIRT1270336	hsa-miR-3159	CLIP-seq
MIRT1270338	hsa-miR-410	CLIP-seq
MIRT1270340	hsa-miR-4704-3p	CLIP-seq
MIRT2079454	hsa-miR-4775	CLIP-seq
MIRT1270341	hsa-miR-4796-5p	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT2079455	hsa-miR-570	CLIP-seq
MIRT1270344	hsa-miR-651	CLIP-seq
MIRT1270333	hsa-miR-1258	CLIP-seq
MIRT1270336	hsa-miR-3159	CLIP-seq
MIRT1270338	hsa-miR-410	CLIP-seq
MIRT2305759	hsa-miR-610	CLIP-seq
MIRT1270344	hsa-miR-651	CLIP-seq
MIRT2602966	hsa-miR-1185	CLIP-seq
MIRT2602967	hsa-miR-1255a	CLIP-seq
MIRT2602968	hsa-miR-1255b	CLIP-seq
MIRT2602969	hsa-miR-2278	CLIP-seq
MIRT2602970	hsa-miR-3138	CLIP-seq
MIRT2602971	hsa-miR-324-5p	CLIP-seq
MIRT2602972	hsa-miR-338-3p	CLIP-seq
MIRT2602973	hsa-miR-3663-3p	CLIP-seq
MIRT2602974	hsa-miR-3668	CLIP-seq
MIRT2602975	hsa-miR-3679-5p	CLIP-seq
MIRT2602976	hsa-miR-3689a-3p	CLIP-seq
MIRT2602977	hsa-miR-3689c	CLIP-seq
MIRT2602978	hsa-miR-4252	CLIP-seq
MIRT2602979	hsa-miR-4496	CLIP-seq
MIRT2602980	hsa-miR-4520a-3p	CLIP-seq
MIRT2602981	hsa-miR-4666-3p	CLIP-seq
MIRT2602982	hsa-miR-4699-5p	CLIP-seq
MIRT1270325	hsa-miR-4728-5p	CLIP-seq
MIRT2602983	hsa-miR-4732-5p	CLIP-seq
MIRT2602984	hsa-miR-491-3p	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT2602985	hsa-miR-562	CLIP-seq
MIRT2602986	hsa-miR-580	CLIP-seq
MIRT2602987	hsa-miR-586	CLIP-seq
MIRT2602988	hsa-miR-941	CLIP-seq
MIRT2602966	hsa-miR-1185	CLIP-seq
MIRT2602967	hsa-miR-1255a	CLIP-seq
MIRT2602968	hsa-miR-1255b	CLIP-seq
MIRT2602969	hsa-miR-2278	CLIP-seq
MIRT2602970	hsa-miR-3138	CLIP-seq
MIRT2602971	hsa-miR-324-5p	CLIP-seq
MIRT2602973	hsa-miR-3663-3p	CLIP-seq
MIRT2602974	hsa-miR-3668	CLIP-seq
MIRT2602975	hsa-miR-3679-5p	CLIP-seq
MIRT2602976	hsa-miR-3689a-3p	CLIP-seq
MIRT2602977	hsa-miR-3689c	CLIP-seq
MIRT2602978	hsa-miR-4252	CLIP-seq
MIRT2602979	hsa-miR-4496	CLIP-seq
MIRT2602980	hsa-miR-4520a-3p	CLIP-seq
MIRT2602981	hsa-miR-4666-3p	CLIP-seq
MIRT2602982	hsa-miR-4699-5p	CLIP-seq
MIRT1270325	hsa-miR-4728-5p	CLIP-seq
MIRT2602983	hsa-miR-4732-5p	CLIP-seq
MIRT2602984	hsa-miR-491-3p	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT2602985	hsa-miR-562	CLIP-seq
MIRT2602986	hsa-miR-580	CLIP-seq
MIRT2602987	hsa-miR-586	CLIP-seq
MIRT2602988	hsa-miR-941	CLIP-seq

Show/Hide all(49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	9295362, 17323924
GO:0000932	Component	P-body	ISS
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	16189514, 16763564, 19490896, 21516116, 22078707, 22901813, 25416956, 26496610, 27107012, 28514442, 31515488, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	9295362
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	16210410, 19946888
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016887	Function	ATPase activity	IDA	9295362
GO:0017025	Function	TBP-class protein binding	IBA	21873635
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0036402	Function	Proteasome-activating ATPase activity	IEA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043197	Component	Dendritic spine	IBA	21873635
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045899	Process	Positive regulation of RNA polymerase II transcription preinitiation complex assembly	IBA	21873635
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IEA
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
154365	9548	ENSG00000161057

Protein

UniProt ID

P35998

Protein name

26S proteasome regulatory subunit 7 (26S proteasome AAA-ATPase subunit RPT1) (Proteasome 26S subunit ATPase 2)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4G , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00004	AAA	212 → 345	ATPase family associated with various cellular activities (AAA)	Domain
PF17862	AAA_lid_3	367 → 411	AAA+ lid domain	Domain

Sequence

MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKIN
ELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAK
FVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGC
KEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHAR
SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN

Sequence length

433

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412