PSMB9 (proteasome 20S subunit beta 9)

Gene

• Entrez ID: 5698
• Gene name: Proteasome 20S subunit beta 9
• Gene symbol: PSMB9
• Synonyms: LMP2, PRAAS3, PSMB6i, RING12, beta1i
• Chromosome: 6
• Chromosome location: 6p21.32
• Summary: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. [provided by RefSeq, Mar 2010]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs369359789	G>A	Pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT508787	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT508788	hsa-miR-659-3p	PAR-CLIP	23446348
MIRT508789	hsa-miR-1257	PAR-CLIP	23446348
MIRT508790	hsa-miR-29b-2-5p	PAR-CLIP	23446348
MIRT508791	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT508792	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT508793	hsa-miR-6732-5p	PAR-CLIP	23446348
MIRT683895	hsa-miR-498	HITS-CLIP	23313552
MIRT683896	hsa-miR-6836-3p	HITS-CLIP	23313552
MIRT683897	hsa-miR-5001-3p	HITS-CLIP	23313552
MIRT683898	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT683899	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT683900	hsa-miR-23b-5p	HITS-CLIP	23313552
MIRT683901	hsa-miR-23a-5p	HITS-CLIP	23313552
MIRT683902	hsa-miR-6829-3p	HITS-CLIP	23313552
MIRT683903	hsa-miR-6791-3p	HITS-CLIP	23313552
MIRT683904	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT683905	hsa-miR-4772-3p	HITS-CLIP	23313552
MIRT683906	hsa-miR-6787-3p	HITS-CLIP	23313552
MIRT683907	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT683908	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT683909	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT683910	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT683911	hsa-miR-660-3p	HITS-CLIP	23313552
MIRT683912	hsa-miR-6736-3p	HITS-CLIP	23313552
MIRT683913	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT683914	hsa-miR-216a-5p	HITS-CLIP	23313552
MIRT783265	hsa-miR-1267	HITS-CLIP	27418678
MIRT784129	hsa-miR-200c-5p	HITS-CLIP	27418678
MIRT784156	hsa-miR-208a-3p	HITS-CLIP	27418678
MIRT784163	hsa-miR-208b-3p	HITS-CLIP	27418678
MIRT784973	hsa-miR-3617-5p	HITS-CLIP	27418678
MIRT785045	hsa-miR-3658	HITS-CLIP	27418678
MIRT785089	hsa-miR-3664-5p	HITS-CLIP	27418678
MIRT785200	hsa-miR-367-5p	HITS-CLIP	27418678
MIRT786501	hsa-miR-4711-3p	HITS-CLIP	27418678
MIRT786509	hsa-miR-4714-5p	HITS-CLIP	27418678
MIRT786922	hsa-miR-499a-5p	HITS-CLIP	27418678
MIRT787169	hsa-miR-514a-5p	HITS-CLIP	27418678
MIRT787608	hsa-miR-550a-3p	HITS-CLIP	27418678
MIRT787613	hsa-miR-550b-3p	HITS-CLIP	27418678
MIRT788175	hsa-miR-641	HITS-CLIP	27418678
MIRT788491	hsa-miR-6733-3p	HITS-CLIP	27418678
MIRT789617	hsa-miR-7856-5p	HITS-CLIP	27418678

Transcription factors

Transcription factor	Regulation	Reference
IRF1	Activation	18694960
IRF1	Unknown	10764778;10921891;16703666;9632673
NFKB1	Unknown	18694960
RELA	Unknown	18694960
SEC14L2	Unknown	7699330
STAT1	Unknown	10764778;10921891;16703666;9632673

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	TAS	8666937
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0004298	Function	Threonine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	14733938, 16957778, 18985028, 20723761, 28514442, 30833792, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IBA	21873635
GO:0005839	Component	Proteasome core complex	ISS
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016032	Process	Viral process	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019774	Component	Proteasome core complex, beta-subunit complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1990111	Component	Spermatoproteasome complex	ISS
GO:2000116	Process	Regulation of cysteine-type endopeptidase activity	IMP	26524591

Other IDs

• MIM: 177045
• HGNC: 9546
• e!Ensembl: ENSG00000240065

Protein

• UniProt ID: P28065
• Protein name: Proteasome subunit beta type-9 (EC 3.4.25.1) (Low molecular mass protein 2) (Macropain chain 7) (Multicatalytic endopeptidase complex chain 7) (Proteasome chain 7) (Proteasome subunit beta-1i) (Really interesting new gene 12 protein)
• Protein function: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues.
• PDB: 6AVO, 6E5B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00227	Proteasome	17 → 198	Proteasome subunit	Domain

• Sequence:

  MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHER
  IYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMV
  AGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIA
  LAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

• Sequence length: 219