PSMB5 (proteasome 20S subunit beta 5)

Gene

• Entrez ID: 5693
• Gene name: Proteasome 20S subunit beta 5
• Gene symbol: PSMB5
• Synonyms: LMPX, MB1, X
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome. This catalytic subunit is not present in the immunoproteasome and is replaced by catalytic subunit 3i (proteasome beta 8 subunit). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021543	hsa-miR-142-3p	Microarray	17612493
MIRT021543	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT031323	hsa-miR-18a-5p	Sequencing	20371350
MIRT042548	hsa-miR-423-3p	CLASH	23622248
MIRT044149	hsa-miR-30e-5p	CLASH	23622248
MIRT046973	hsa-miR-221-3p	CLASH	23622248
MIRT137935	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT630274	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT630275	hsa-miR-4430	HITS-CLIP	23824327
MIRT630276	hsa-miR-3652	HITS-CLIP	23824327
MIRT630277	hsa-miR-593-5p	HITS-CLIP	23824327
MIRT630278	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT630279	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT630280	hsa-miR-3135b	HITS-CLIP	23824327
MIRT630281	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT630282	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT630283	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT630284	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT630285	hsa-miR-183-5p	HITS-CLIP	23824327
MIRT630286	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT630287	hsa-miR-4295	HITS-CLIP	23824327
MIRT630288	hsa-miR-3666	HITS-CLIP	23824327
MIRT630289	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT630290	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT630291	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT630292	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT630293	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT636302	hsa-miR-4482-3p	HITS-CLIP	23824327
MIRT636303	hsa-miR-7159-3p	HITS-CLIP	23824327
MIRT636304	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT636305	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT636306	hsa-miR-651-3p	HITS-CLIP	23824327
MIRT654668	hsa-miR-488-3p	HITS-CLIP	23824327
MIRT654669	hsa-miR-506-3p	HITS-CLIP	23824327
MIRT654670	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT654671	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT654672	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT654673	hsa-miR-4287	HITS-CLIP	23824327
MIRT654674	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT654675	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT654676	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT654677	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT654678	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT654679	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT654680	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT654681	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT654682	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT654683	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT654684	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT654685	hsa-miR-3605-3p	HITS-CLIP	23824327
MIRT654686	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT654687	hsa-miR-4469	HITS-CLIP	23824327
MIRT654688	hsa-miR-1248	HITS-CLIP	23824327
MIRT654689	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT654690	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT654691	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT654692	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT654693	hsa-miR-3183	HITS-CLIP	23824327
MIRT654694	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT654695	hsa-miR-5193	HITS-CLIP	23824327
MIRT654696	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT654697	hsa-miR-1470	HITS-CLIP	23824327
MIRT666802	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT726851	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT726852	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT726853	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT726854	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT783046	hsa-miR-103a-2-5p	HITS-CLIP	27418678
MIRT783178	hsa-miR-1229-3p	HITS-CLIP	27418678
MIRT784030	hsa-miR-1914-5p	HITS-CLIP	27418678
MIRT784036	hsa-miR-192-5p	HITS-CLIP	27418678
MIRT784242	hsa-miR-215-5p	HITS-CLIP	27418678
MIRT784255	hsa-miR-218-5p	HITS-CLIP	27418678
MIRT786968	hsa-miR-5008-3p	HITS-CLIP	27418678
MIRT788167	hsa-miR-636	HITS-CLIP	27418678
MIRT788505	hsa-miR-6737-3p	HITS-CLIP	27418678
MIRT789448	hsa-miR-7157-3p	HITS-CLIP	27418678

Transcription factors

Transcription factor	Regulation	Reference
STAT3	Activation	24627483

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0004298	Function	Threonine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	14733938, 15231747, 17948026, 20723761, 28514442, 32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IBA	21873635
GO:0005839	Component	Proteasome core complex	ISS
GO:0006508	Process	Proteolysis	IDA	17540904
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0006979	Process	Response to oxidative stress	IEA
GO:0008233	Function	Peptidase activity	IDA	17540904
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016032	Process	Viral process	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019774	Component	Proteasome core complex, beta-subunit complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

Other IDs

• MIM: 600306
• HGNC: 9542
• e!Ensembl: ENSG00000100804

Protein

• UniProt ID: P28074
• Protein name: Proteasome subunit beta type-5 (EC 3.4.25.1) (Macropain epsilon chain) (Multicatalytic endopeptidase complex epsilon chain) (Proteasome chain 6) (Proteasome epsilon chain) (Proteasome subunit MB1) (Proteasome subunit X)
• Protein function: Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Within the 20S core complex, PSMB5 displays a chymotrypsin-like activity.
• PDB: 4R3O, 4R67, 5A0Q, 5GJQ, 5GJR, 5L4G, 5L5W, 5L5X, 5L5Y, 5L5Z, 5L60, 5L61, 5L62, 5L63, 5L64, 5LE5, 5LEX, 5LEY, 5LEZ, 5LF0, 5LF1, 5LF3, 5LF4, 5LF6, 5LF7, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFO, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 6KWY, 6MSB, 6MSD, 6MSE, 6MSG, 6MSH, 6MSJ, 6MSK, 6R70, 6REY, 6RGQ, 6WJD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00227	Proteasome	56 → 238	Proteasome subunit	Domain

• Sequence:

  MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
  TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
  QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
  SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
  DGWIRVSSDNVADLHEKYSGSTP

• Sequence length: 263