PSMB11 (proteasome subunit beta 11)

Gene

• Entrez ID: 122706
• Gene name: Proteasome subunit beta 11
• Gene symbol: PSMB11
• Synonyms: BETA5T
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: Proteasomes generate peptides that are presented by major histocompatibility complex (MHC) I molecules to other cells of the immune system. Proteolysis is conducted by 20S proteasomes, complexes of 28 subunits arranged as a cylinder in 4 heteroheptameric

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1270080	hsa-miR-3617	CLIP-seq
MIRT1270081	hsa-miR-4252	CLIP-seq
MIRT1270082	hsa-miR-4311	CLIP-seq
MIRT1270083	hsa-miR-4318	CLIP-seq
MIRT1270084	hsa-miR-4693-5p	CLIP-seq
MIRT1270085	hsa-miR-4722-3p	CLIP-seq
MIRT1270086	hsa-miR-4725-5p	CLIP-seq
MIRT1270087	hsa-miR-4777-3p	CLIP-seq
MIRT1270088	hsa-miR-504	CLIP-seq
MIRT1270089	hsa-miR-641	CLIP-seq
MIRT1270090	hsa-miR-892a	CLIP-seq
MIRT2079431	hsa-miR-596	CLIP-seq
MIRT2079432	hsa-miR-642a	CLIP-seq
MIRT2079433	hsa-miR-671-5p	CLIP-seq
MIRT2305689	hsa-miR-127-5p	CLIP-seq
MIRT2305690	hsa-miR-143	CLIP-seq
MIRT2305691	hsa-miR-3134	CLIP-seq
MIRT2305692	hsa-miR-3148	CLIP-seq
MIRT2305693	hsa-miR-3688-3p	CLIP-seq
MIRT2305694	hsa-miR-3919	CLIP-seq
MIRT2305695	hsa-miR-4329	CLIP-seq
MIRT2305696	hsa-miR-4534	CLIP-seq
MIRT2305697	hsa-miR-4770	CLIP-seq
MIRT2305698	hsa-miR-4789-3p	CLIP-seq
MIRT2305699	hsa-miR-642b	CLIP-seq
MIRT2457328	hsa-miR-1275	CLIP-seq
MIRT2457329	hsa-miR-1587	CLIP-seq
MIRT2457330	hsa-miR-3151	CLIP-seq
MIRT2457331	hsa-miR-4417	CLIP-seq
MIRT2457332	hsa-miR-4447	CLIP-seq
MIRT2457333	hsa-miR-4472	CLIP-seq
MIRT2457334	hsa-miR-4492	CLIP-seq
MIRT2457335	hsa-miR-4498	CLIP-seq
MIRT2457336	hsa-miR-4525	CLIP-seq
MIRT2457337	hsa-miR-4656	CLIP-seq
MIRT2457338	hsa-miR-4665-5p	CLIP-seq
MIRT2457339	hsa-miR-4675	CLIP-seq
MIRT2457340	hsa-miR-4723-5p	CLIP-seq
MIRT2457341	hsa-miR-4741	CLIP-seq
MIRT2457342	hsa-miR-491-5p	CLIP-seq
MIRT2457343	hsa-miR-541	CLIP-seq
MIRT2457344	hsa-miR-625	CLIP-seq
MIRT2457345	hsa-miR-654-5p	CLIP-seq
MIRT2457346	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0004298	Function	Threonine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IBA	21873635
GO:0006508	Process	Proteolysis	IDA	17540904
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008233	Function	Peptidase activity	IDA	17540904
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019774	Component	Proteasome core complex, beta-subunit complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043374	Process	CD8-positive, alpha-beta T cell differentiation	IEA
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

Other IDs

• MIM: 611137
• HGNC: 31963
• e!Ensembl: ENSG00000222028

Protein

• UniProt ID: A5LHX3
• Protein name: Proteasome subunit beta type-11 (EC 3.4.25.1) (Proteasome subunit beta-5t)
• Protein function: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent pr
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00227	Proteasome	46 → 228	Proteasome subunit	Domain

• Sequence:

  MALQDVCKWQSPDTQGPSPHLPRAGGWAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFRHG
  VIAAADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREG
  QLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSG
  SPYAYGVLDRGYRYDMSTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEHVSRSD
  ACVLYVELQKLLEPEPEEDASHAHPEPATAHRAAEDRELSVGPGEVTPGDSRMPAGTETV
  

• Sequence length: 300