PSMA8 (proteasome 20S subunit alpha 8)

Gene

• Entrez ID: 143471
• Gene name: Proteasome 20S subunit alpha 8
• Gene symbol: PSMA8
• Synonyms: PSMA7L
• Chromosome: 18
• Chromosome location: 18q11.2

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IBA	21873635
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0007283	Process	Spermatogenesis	IEA
GO:0010498	Process	Proteasomal protein catabolic process	ISS
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IBA	21873635
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0051321	Process	Meiotic cell cycle	ISS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0060631	Process	Regulation of meiosis I	IEA
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1990111	Component	Spermatoproteasome complex	ISS

Other IDs

• MIM: 617841
• HGNC: 22985
• e!Ensembl: ENSG00000154611

Protein

• UniProt ID: Q8TAA3
• Protein name: Proteasome subunit alpha-type 8 (Proteasome alpha 4 subunit) (Alpha4s) (Proteasome subunit alpha-type 7-like)
• Protein function: Component of the spermatoproteasome, a proteasome specifically found in testis that promotes acetylation-dependent degradation of histones, thereby participating actively to the exchange of histones during spermatogenesis. The proteasome is a protein complexe that degrades unneeded or damaged proteins by proteolysis, a chemical reaction that breaks peptide bonds. Required for 20S core proteasome assembly, essential for the degradation of meiotic proteins RAD51 and RPA1 at late prophase I and the progression of meiosis I during spermatogenesis. Localizes to the synaptonemal complex, a 'zipper'-like structure that holds homologous chromosome pairs in synapsis during meiotic prophase I.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10584	Proteasome_A_N	5 → 27	Proteasome subunit A N-terminal signature	Family
  PF00227	Proteasome	28 → 219	Proteasome subunit	Domain

• Sequence:

  MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERT
  VRKICALDDHVCMAFAVLTIFIGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIA
  TLKQKYTQSNGRRPFGISALIVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFL
  EKNYTEDAIASDSEAIKLAIKALLEVVQSGGKNIELAIIRRNQPLKMFSAKEVELYVTEI
  EKEKEEAEKKKSKKSV

• Sequence length: 256