GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

PSMA1 (proteasome 20S subunit alpha 1)

Gene

5682

Proteasome 20S subunit alpha 1

PSMA1

HC2, HEL-S-275, NU, PROS30

11p15.2

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Show/Hide all(128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT454272	hsa-miR-548l	PAR-CLIP	23592263
MIRT454270	hsa-miR-3973	PAR-CLIP	23592263
MIRT454271	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT454269	hsa-miR-520h	PAR-CLIP	23592263
MIRT454267	hsa-miR-4772-3p	PAR-CLIP	23592263
MIRT454268	hsa-miR-891b	PAR-CLIP	23592263
MIRT454266	hsa-miR-5701	PAR-CLIP	23592263
MIRT454265	hsa-miR-218-1-3p	PAR-CLIP	23592263
MIRT454263	hsa-miR-659-3p	PAR-CLIP	23592263
MIRT454272	hsa-miR-548l	PAR-CLIP	23592263
MIRT454270	hsa-miR-3973	PAR-CLIP	23592263
MIRT454271	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT454269	hsa-miR-520h	PAR-CLIP	23592263
MIRT454267	hsa-miR-4772-3p	PAR-CLIP	23592263
MIRT454268	hsa-miR-891b	PAR-CLIP	23592263
MIRT454266	hsa-miR-5701	PAR-CLIP	23592263
MIRT454265	hsa-miR-218-1-3p	PAR-CLIP	23592263
MIRT454263	hsa-miR-659-3p	PAR-CLIP	23592263
MIRT1269924	hsa-miR-1200	CLIP-seq
MIRT1269925	hsa-miR-3074-5p	CLIP-seq
MIRT1269926	hsa-miR-3140-5p	CLIP-seq
MIRT1269927	hsa-miR-4670-3p	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT1269929	hsa-miR-2276	CLIP-seq
MIRT1269930	hsa-miR-299-3p	CLIP-seq
MIRT1269931	hsa-miR-3161	CLIP-seq
MIRT1269932	hsa-miR-369-3p	CLIP-seq
MIRT1269933	hsa-miR-374c	CLIP-seq
MIRT1269934	hsa-miR-4491	CLIP-seq
MIRT1269935	hsa-miR-4657	CLIP-seq
MIRT1269936	hsa-miR-4742-3p	CLIP-seq
MIRT1269937	hsa-miR-520g	CLIP-seq
MIRT1269938	hsa-miR-550a	CLIP-seq
MIRT1269939	hsa-miR-600	CLIP-seq
MIRT1269940	hsa-miR-630	CLIP-seq
MIRT1269941	hsa-miR-655	CLIP-seq
MIRT1269942	hsa-miR-659	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT1269943	hsa-miR-1273e	CLIP-seq
MIRT1269944	hsa-miR-1294	CLIP-seq
MIRT1269929	hsa-miR-2276	CLIP-seq
MIRT1269930	hsa-miR-299-3p	CLIP-seq
MIRT1269945	hsa-miR-3148	CLIP-seq
MIRT1269946	hsa-miR-3662	CLIP-seq
MIRT1269947	hsa-miR-3978	CLIP-seq
MIRT1269948	hsa-miR-4276	CLIP-seq
MIRT1269949	hsa-miR-4464	CLIP-seq
MIRT1269934	hsa-miR-4491	CLIP-seq
MIRT1269950	hsa-miR-4528	CLIP-seq
MIRT1269935	hsa-miR-4657	CLIP-seq
MIRT1269936	hsa-miR-4742-3p	CLIP-seq
MIRT1269951	hsa-miR-4748	CLIP-seq
MIRT1269952	hsa-miR-4777-5p	CLIP-seq
MIRT1269953	hsa-miR-4789-5p	CLIP-seq
MIRT1269954	hsa-miR-518d-5p	CLIP-seq
MIRT1269955	hsa-miR-519b-5p	CLIP-seq
MIRT1269956	hsa-miR-519c-5p	CLIP-seq
MIRT1269957	hsa-miR-520c-5p	CLIP-seq
MIRT1269937	hsa-miR-520g	CLIP-seq
MIRT1269958	hsa-miR-526a	CLIP-seq
MIRT1269959	hsa-miR-548ae	CLIP-seq
MIRT1269960	hsa-miR-548aj	CLIP-seq
MIRT1269961	hsa-miR-548am	CLIP-seq
MIRT1269962	hsa-miR-548x	CLIP-seq
MIRT1269938	hsa-miR-550a	CLIP-seq
MIRT1269939	hsa-miR-600	CLIP-seq
MIRT1269940	hsa-miR-630	CLIP-seq
MIRT1269942	hsa-miR-659	CLIP-seq
MIRT1269963	hsa-miR-660	CLIP-seq
MIRT1269964	hsa-miR-885-5p	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT1269946	hsa-miR-3662	CLIP-seq
MIRT1269952	hsa-miR-4777-5p	CLIP-seq
MIRT1269953	hsa-miR-4789-5p	CLIP-seq
MIRT1269954	hsa-miR-518d-5p	CLIP-seq
MIRT1269955	hsa-miR-519b-5p	CLIP-seq
MIRT1269956	hsa-miR-519c-5p	CLIP-seq
MIRT1269957	hsa-miR-520c-5p	CLIP-seq
MIRT1269958	hsa-miR-526a	CLIP-seq
MIRT1269959	hsa-miR-548ae	CLIP-seq
MIRT1269960	hsa-miR-548aj	CLIP-seq
MIRT1269961	hsa-miR-548am	CLIP-seq
MIRT1269962	hsa-miR-548x	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT2602752	hsa-miR-128	CLIP-seq
MIRT2602753	hsa-miR-151-3p	CLIP-seq
MIRT1269929	hsa-miR-2276	CLIP-seq
MIRT2602754	hsa-miR-27a	CLIP-seq
MIRT2602755	hsa-miR-27b	CLIP-seq
MIRT1269930	hsa-miR-299-3p	CLIP-seq
MIRT1269931	hsa-miR-3161	CLIP-seq
MIRT1269932	hsa-miR-369-3p	CLIP-seq
MIRT1269933	hsa-miR-374c	CLIP-seq
MIRT2602756	hsa-miR-4463	CLIP-seq
MIRT1269934	hsa-miR-4491	CLIP-seq
MIRT2602757	hsa-miR-4499	CLIP-seq
MIRT1269935	hsa-miR-4657	CLIP-seq
MIRT1269936	hsa-miR-4742-3p	CLIP-seq
MIRT2602758	hsa-miR-494	CLIP-seq
MIRT2602759	hsa-miR-511	CLIP-seq
MIRT2602760	hsa-miR-513a-5p	CLIP-seq
MIRT1269937	hsa-miR-520g	CLIP-seq
MIRT1269938	hsa-miR-550a	CLIP-seq
MIRT2602761	hsa-miR-590-3p	CLIP-seq
MIRT1269939	hsa-miR-600	CLIP-seq
MIRT1269940	hsa-miR-630	CLIP-seq
MIRT1269941	hsa-miR-655	CLIP-seq
MIRT1269942	hsa-miR-659	CLIP-seq
MIRT2602762	hsa-miR-892b	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT2602753	hsa-miR-151-3p	CLIP-seq
MIRT1269929	hsa-miR-2276	CLIP-seq
MIRT1269930	hsa-miR-299-3p	CLIP-seq
MIRT1269931	hsa-miR-3161	CLIP-seq
MIRT1269932	hsa-miR-369-3p	CLIP-seq
MIRT1269933	hsa-miR-374c	CLIP-seq
MIRT2602756	hsa-miR-4463	CLIP-seq
MIRT1269934	hsa-miR-4491	CLIP-seq
MIRT2602757	hsa-miR-4499	CLIP-seq
MIRT1269935	hsa-miR-4657	CLIP-seq
MIRT1269936	hsa-miR-4742-3p	CLIP-seq
MIRT1269937	hsa-miR-520g	CLIP-seq
MIRT1269938	hsa-miR-550a	CLIP-seq
MIRT1269939	hsa-miR-600	CLIP-seq
MIRT1269940	hsa-miR-630	CLIP-seq
MIRT1269941	hsa-miR-655	CLIP-seq
MIRT1269942	hsa-miR-659	CLIP-seq
MIRT2602762	hsa-miR-892b	CLIP-seq

Show/Hide all(45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0001530	Function	Lipopolysaccharide binding	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0003723	Function	RNA binding	TAS	7681138
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	12376572, 14733938, 15225636, 16189514, 17292860, 17948026, 19060904, 21516116, 21988832, 25416956, 25599644, 29568061, 29636472, 29804830, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IBA	21873635
GO:0005839	Component	Proteasome core complex	ISS
GO:0005844	Component	Polysome	TAS	7681138
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IBA	21873635
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

MIM	HGNC	e!Ensembl
602854	9530	ENSG00000129084

Protein

UniProt ID

P25786

Protein name

Proteasome subunit alpha type-1 (30 kDa prosomal protein) (PROS-30) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome component C2) (Proteasome nu chain) (Proteasome subunit alpha-6) (alpha-6)

Protein function

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with

PDB

4R3O , 4R67 , 5A0Q , 5GJQ , 5GJR , 5L4G , 5LE5 , 5LEX , 5LEY , 5LEZ , 5LF0 , 5LF1 , 5LF3 , 5LF4 , 5LF6 , 5LF7 , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFO , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 6AVO , 6E5B , 6KWY , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6R70 , 6REY , 6RGQ , 6WJD , 6WJN , 6XMJ , 7AWE , 7B12 , 7LXV , 7NAN , 7NAO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10584	Proteasome_A_N	6 → 28	Proteasome subunit A N-terminal signature	Family
PF00227	Proteasome	29 → 215	Proteasome subunit	Domain

Sequence

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ
KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT
QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM
ECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP
QRKAQPAQPADEPAEKADEPMEH

Sequence length

263

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412