PSIP1 (PC4 and SFRS1 interacting protein 1)

Gene

• Entrez ID: 11168
• Gene name: PC4 and SFRS1 interacting protein 1
• Gene symbol: PSIP1
• Synonyms: DFS70, LEDGF, PAIP, PSIP2, p52, p75
• Chromosome: 9
• Chromosome location: 9p22.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016293	hsa-miR-193b-3p	Microarray	20304954
MIRT016293	hsa-miR-193b-3p	CLASH	23622248
MIRT019773	hsa-miR-375	Microarray	20215506
MIRT020538	hsa-miR-155-5p	Proteomics	18668040
MIRT020538	hsa-miR-155-5p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23028330
MIRT020538	hsa-miR-155-5p	ChIP-seq, Luciferase reporter assay, Western blot	26497687
MIRT023558	hsa-miR-1-3p	Proteomics	18668040
MIRT023558	hsa-miR-1-3p	Proteomics;Microarray	18668037

Transcription factors

Transcription factor	Regulation	Reference
HDAC1	Unknown	23386123
SP1	Unknown	22019592;23386123

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000395	Process	MRNA 5'-splice site recognition	IDA	9885563
GO:0003690	Function	Double-stranded DNA binding	IBA	21873635
GO:0003712	Function	Transcription coregulator activity	IBA	21873635
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	21156026, 22748127, 22773103, 25082813, 25305204, 29997176
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006979	Process	Response to oxidative stress	ISS
GO:0009408	Process	Response to heat	ISS
GO:0035327	Component	Transcriptionally active chromatin	ISS
GO:0051169	Process	Nuclear transport	TAS
GO:0075713	Process	Establishment of integrated proviral latency	TAS
GO:0097100	Function	Supercoiled DNA binding	ISS

Other IDs

• MIM: 603620
• HGNC: 9527
• e!Ensembl: ENSG00000164985

Protein

• UniProt ID: O75475
• Protein name: PC4 and SFRS1-interacting protein (CLL-associated antigen KW-7) (Dense fine speckles 70 kDa protein) (DFS 70) (Lens epithelium-derived growth factor) (Transcriptional coactivator p75/p52)
• Protein function: Transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell terminal differentiation. May play a protective role during stress-induced apoptosis. Isoform 2 is a more general and stronger transcriptional coactivator. Isoform 2 may also act as an adapter to coordinate pre-mRNA splicing. Cellular cofactor for lentiviral integration.
• PDB: 1Z9E, 2B4J, 2M16, 2MSR, 2MTN, 2N3A, 3F9K, 3HPG, 3HPH, 3U88, 3ZEH, 4FU6, 5N88, 5OYM, 5YI9, 6EMO, 6EMP, 6EMQ, 6EMR, 6S01, 6TRJ, 6TVM, 6Z2Y
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00855	PWWP	5 → 89	PWWP domain	Domain
  PF11467	LEDGF	349 → 450	Lens epithelium-derived growth factor (LEDGF)	Domain

• Sequence:

  MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFP
  YSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKE
  DTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKR
  GRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKE
  EDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRR
  NMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
  NSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY
  NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNG
  GSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN

• Sequence length: 530