PRKCQ (protein kinase C theta)

Gene

• Entrez ID: 5588
• Gene name: Protein kinase C theta
• Gene symbol: PRKCQ
• Synonyms: PRKCT, nPKC-theta
• Chromosome: 10
• Chromosome location: 10p15.1
• Summary: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs2236379	G>A,C	Pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1263387	hsa-miR-3659	CLIP-seq
MIRT1263388	hsa-miR-4658	CLIP-seq
MIRT1263389	hsa-miR-4758-5p	CLIP-seq
MIRT1263390	hsa-miR-574-5p	CLIP-seq
MIRT1263391	hsa-miR-622	CLIP-seq
MIRT1263392	hsa-miR-653	CLIP-seq
MIRT2304083	hsa-miR-221	CLIP-seq
MIRT2304084	hsa-miR-222	CLIP-seq
MIRT2304085	hsa-miR-4726-3p	CLIP-seq
MIRT2304086	hsa-miR-544	CLIP-seq
MIRT2304087	hsa-miR-548v	CLIP-seq
MIRT2304088	hsa-miR-577	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
RUNX1	Unknown	21252065

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	NAS	8444877
GO:0001772	Component	Immunological synapse	IEA
GO:0004672	Function	Protein kinase activity	TAS
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	16356856
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	8444877
GO:0004698	Function	Calcium-dependent protein kinase C activity	IEA
GO:0005515	Function	Protein binding	IPI	10383400, 10636891, 11788586, 15254234, 17588663, 21964608, 21983831, 23352416, 23509302
GO:0005524	Function	ATP binding	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006355	Process	Regulation of transcription, DNA-templated	ISS
GO:0006509	Process	Membrane protein ectodomain proteolysis	ISS
GO:0006954	Process	Inflammatory response	IEA
GO:0007411	Process	Axon guidance	TAS
GO:0016235	Component	Aggresome	IDA
GO:0018105	Process	Peptidyl-serine phosphorylation	IBA	21873635
GO:0030168	Process	Platelet activation	TAS
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IMP	21531765
GO:0032740	Process	Positive regulation of interleukin-17 production	ISS
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	ISS
GO:0034451	Component	Centriolar satellite	IDA
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0035556	Process	Intracellular signal transduction	NAS	7686153
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0045652	Process	Regulation of megakaryocyte differentiation	TAS
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IMP	15364919
GO:0046872	Function	Metal ion binding	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050870	Process	Positive regulation of T cell activation	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	16356855
GO:0051973	Process	Positive regulation of telomerase activity	IMP	21531765
GO:0060326	Process	Cell chemotaxis	IMP	24008408
GO:0070233	Process	Negative regulation of T cell apoptotic process	IMP	11342610, 16709830
GO:0090330	Process	Regulation of platelet aggregation	ISS
GO:1904355	Process	Positive regulation of telomere capping	IMP	21531765
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	ISS
GO:2000570	Process	Positive regulation of T-helper 2 cell activation	ISS

Other IDs

• MIM: 600448
• HGNC: 9410
• e!Ensembl: ENSG00000065675

Protein

• UniProt ID: Q04759
• Protein name: Protein kinase C theta type (EC 2.7.11.13) (nPKC-theta)
• Protein function: Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that mediates non-redundant functions in T-cell receptor (TCR) signaling, including T-cells activation, proliferation, differentiation and surv
• PDB: 1XJD, 2ENJ, 2ENN, 2ENZ, 2JED, 4Q9Z, 4RA5, 5F9E
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00130	C1_1	160 → 212	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
  PF00130	C1_1	232 → 284	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
  PF00069	Pkinase	380 → 634	Protein kinase domain	Domain
  PF00433	Pkinase_C	655 → 696	Protein kinase C terminal domain	Family

• Sequence:

  MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
  DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNAR
  YFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
  WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
  SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
  ARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLP
  EPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
  DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
  ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFC
  GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
  WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFD
  CSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPGMERLIS

• Sequence length: 706