GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

PRKCD (protein kinase C delta)

Gene

5580

Protein kinase C delta

PRKCD

ALPS3, CVID9, MAY1, PKCD, nPKC-delta

3p21.1

The protein encoded by this gene is a member of the protein kinase C family of serine- and threonine-specific protein kinases. The encoded protein is activated by diacylglycerol and is both a tumor suppressor and a positive regulator of cell cycle progres

Show/Hide all(5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs33911937	A>G	Conflicting-interpretations-of-pathogenicity	Intron variant, missense variant, coding sequence variant
rs398122958	G>A	Pathogenic	Splice donor variant
rs606231296	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs606231297	C>T	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1295207359	A>G	Likely-pathogenic	Splice acceptor variant

Show/Hide all(195)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041814	hsa-miR-484	CLASH	23622248
MIRT039609	hsa-miR-615-3p	CLASH	23622248
MIRT039609	hsa-miR-615-3p	CLASH	23622248
MIRT053097	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	23525216
MIRT163342	hsa-miR-181a-5p	Luciferase reporter assay	24183997
MIRT163342	hsa-miR-181a-5p	Luciferase reporter assay	24183997
MIRT163342	hsa-miR-181a-5p	Luciferase reporter assay	24183997
MIRT163342	hsa-miR-181a-5p	Luciferase reporter assay	24183997
MIRT163378	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT163346	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT613705	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT163378	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT613708	hsa-miR-4268	HITS-CLIP	23824327
MIRT613707	hsa-miR-4448	HITS-CLIP	23824327
MIRT163346	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT613706	hsa-miR-6772-3p	HITS-CLIP	23824327
MIRT613705	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT163363	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT163384	hsa-miR-6856-3p	PAR-CLIP	21572407
MIRT163348	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT163380	hsa-miR-5692b	PAR-CLIP	21572407
MIRT163379	hsa-miR-5692c	PAR-CLIP	21572407
MIRT163350	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT163378	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT515489	hsa-miR-654-3p	PAR-CLIP	21572407
MIRT515488	hsa-miR-4796-5p	PAR-CLIP	21572407
MIRT163349	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT163358	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT163346	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT163369	hsa-miR-3924	PAR-CLIP	21572407
MIRT163363	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT163348	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT163380	hsa-miR-5692b	PAR-CLIP	23446348
MIRT163379	hsa-miR-5692c	PAR-CLIP	23446348
MIRT163350	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT163378	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT515489	hsa-miR-654-3p	PAR-CLIP	23446348
MIRT515488	hsa-miR-4796-5p	PAR-CLIP	23446348
MIRT163349	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT163358	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT163346	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT163369	hsa-miR-3924	PAR-CLIP	23446348
MIRT163362	hsa-miR-1305	PAR-CLIP	23446348
MIRT163253	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT163257	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT163254	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT163261	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT163342	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT163343	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT163344	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT163351	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT053097	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT163340	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT163342	hsa-miR-181a-5p	qRT-PCR, Luciferase reporter assay, Western blot	25174404
MIRT163342	hsa-miR-181a-5p	qRT-PCR, Luciferase reporter assay, Western blot	25174404
MIRT163344	hsa-miR-181c-5p	Luciferase reporter assay	26629004
MIRT163344	hsa-miR-181c-5p	Luciferase reporter assay	26629004
MIRT053097	hsa-miR-26a-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR, ELISA	31907356
MIRT163340	hsa-miR-26b-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR, ELISA	31907356
MIRT163378	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT163346	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT613705	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT163378	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT613708	hsa-miR-4268	HITS-CLIP	23824327
MIRT613707	hsa-miR-4448	HITS-CLIP	23824327
MIRT163346	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT613706	hsa-miR-6772-3p	HITS-CLIP	23824327
MIRT613705	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT163363	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT163384	hsa-miR-6856-3p	PAR-CLIP	21572407
MIRT163348	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT163380	hsa-miR-5692b	PAR-CLIP	21572407
MIRT163379	hsa-miR-5692c	PAR-CLIP	21572407
MIRT163350	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT163378	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT515489	hsa-miR-654-3p	PAR-CLIP	21572407
MIRT515488	hsa-miR-4796-5p	PAR-CLIP	21572407
MIRT163349	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT163358	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT163346	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT163369	hsa-miR-3924	PAR-CLIP	21572407
MIRT163363	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT163348	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT163380	hsa-miR-5692b	PAR-CLIP	23446348
MIRT163379	hsa-miR-5692c	PAR-CLIP	23446348
MIRT163350	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT163378	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT515489	hsa-miR-654-3p	PAR-CLIP	23446348
MIRT515488	hsa-miR-4796-5p	PAR-CLIP	23446348
MIRT163349	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT163358	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT163346	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT163369	hsa-miR-3924	PAR-CLIP	23446348
MIRT163362	hsa-miR-1305	PAR-CLIP	23446348
MIRT1263054	hsa-miR-1207-5p	CLIP-seq
MIRT1263055	hsa-miR-1293	CLIP-seq
MIRT1263056	hsa-miR-3616-3p	CLIP-seq
MIRT1263057	hsa-miR-3665	CLIP-seq
MIRT1263058	hsa-miR-3934	CLIP-seq
MIRT1263059	hsa-miR-4436b-3p	CLIP-seq
MIRT1263060	hsa-miR-4483	CLIP-seq
MIRT1263061	hsa-miR-4763-3p	CLIP-seq
MIRT1263062	hsa-miR-1297	CLIP-seq
MIRT1263063	hsa-miR-181a	CLIP-seq
MIRT1263064	hsa-miR-181b	CLIP-seq
MIRT1263065	hsa-miR-181c	CLIP-seq
MIRT1263066	hsa-miR-181d	CLIP-seq
MIRT1263067	hsa-miR-26a	CLIP-seq
MIRT1263068	hsa-miR-26b	CLIP-seq
MIRT1263069	hsa-miR-4262	CLIP-seq
MIRT1263070	hsa-miR-4465	CLIP-seq
MIRT1263071	hsa-miR-494	CLIP-seq
MIRT1263072	hsa-miR-606	CLIP-seq
MIRT2077439	hsa-miR-374a	CLIP-seq
MIRT2077440	hsa-miR-374b	CLIP-seq
MIRT2077441	hsa-miR-3942-5p	CLIP-seq
MIRT2077442	hsa-miR-410	CLIP-seq
MIRT2077443	hsa-miR-4684-5p	CLIP-seq
MIRT2077444	hsa-miR-4703-5p	CLIP-seq
MIRT2077445	hsa-miR-4719	CLIP-seq
MIRT2077446	hsa-miR-4768-5p	CLIP-seq
MIRT2077447	hsa-miR-490-3p	CLIP-seq
MIRT2303976	hsa-miR-1226	CLIP-seq
MIRT1263055	hsa-miR-1293	CLIP-seq
MIRT2303977	hsa-miR-140-3p	CLIP-seq
MIRT2303978	hsa-miR-15a	CLIP-seq
MIRT2303979	hsa-miR-15b	CLIP-seq
MIRT2303980	hsa-miR-16	CLIP-seq
MIRT2303981	hsa-miR-1908	CLIP-seq
MIRT2303982	hsa-miR-195	CLIP-seq
MIRT2303983	hsa-miR-197	CLIP-seq
MIRT2303984	hsa-miR-224	CLIP-seq
MIRT2303985	hsa-miR-27a	CLIP-seq
MIRT2303986	hsa-miR-27b	CLIP-seq
MIRT2303987	hsa-miR-298	CLIP-seq
MIRT2303988	hsa-miR-3125	CLIP-seq
MIRT2303989	hsa-miR-3150a-3p	CLIP-seq
MIRT2303990	hsa-miR-3156-3p	CLIP-seq
MIRT2303991	hsa-miR-3175	CLIP-seq
MIRT2303992	hsa-miR-3180	CLIP-seq
MIRT2303993	hsa-miR-3180-3p	CLIP-seq
MIRT2303994	hsa-miR-3196	CLIP-seq
MIRT2303995	hsa-miR-361-3p	CLIP-seq
MIRT1263057	hsa-miR-3665	CLIP-seq
MIRT2303996	hsa-miR-3677-3p	CLIP-seq
MIRT2303997	hsa-miR-377	CLIP-seq
MIRT2303998	hsa-miR-3907	CLIP-seq
MIRT2303999	hsa-miR-3916	CLIP-seq
MIRT1263058	hsa-miR-3934	CLIP-seq
MIRT2304000	hsa-miR-3940-3p	CLIP-seq
MIRT2077441	hsa-miR-3942-5p	CLIP-seq
MIRT2304001	hsa-miR-424	CLIP-seq
MIRT2304002	hsa-miR-4301	CLIP-seq
MIRT1263060	hsa-miR-4483	CLIP-seq
MIRT2304003	hsa-miR-4530	CLIP-seq
MIRT2304004	hsa-miR-4640-5p	CLIP-seq
MIRT2077443	hsa-miR-4684-5p	CLIP-seq
MIRT2077444	hsa-miR-4703-5p	CLIP-seq
MIRT2304005	hsa-miR-4712-3p	CLIP-seq
MIRT2304006	hsa-miR-4726-5p	CLIP-seq
MIRT2304007	hsa-miR-4733-3p	CLIP-seq
MIRT2304008	hsa-miR-4736	CLIP-seq
MIRT2077446	hsa-miR-4768-5p	CLIP-seq
MIRT2304009	hsa-miR-491-5p	CLIP-seq
MIRT2304010	hsa-miR-497	CLIP-seq
MIRT2304011	hsa-miR-513a-5p	CLIP-seq
MIRT2304012	hsa-miR-548q	CLIP-seq
MIRT2304013	hsa-miR-663	CLIP-seq
MIRT2304014	hsa-miR-744	CLIP-seq
MIRT2304015	hsa-miR-922	CLIP-seq
MIRT2304016	hsa-miR-939	CLIP-seq
MIRT2303985	hsa-miR-27a	CLIP-seq
MIRT2303986	hsa-miR-27b	CLIP-seq
MIRT2303988	hsa-miR-3125	CLIP-seq
MIRT2303997	hsa-miR-377	CLIP-seq
MIRT2303999	hsa-miR-3916	CLIP-seq
MIRT2304011	hsa-miR-513a-5p	CLIP-seq
MIRT2303985	hsa-miR-27a	CLIP-seq
MIRT2303986	hsa-miR-27b	CLIP-seq
MIRT2303988	hsa-miR-3125	CLIP-seq
MIRT2303997	hsa-miR-377	CLIP-seq
MIRT2303999	hsa-miR-3916	CLIP-seq
MIRT2304000	hsa-miR-3940-3p	CLIP-seq
MIRT2304005	hsa-miR-4712-3p	CLIP-seq
MIRT2304011	hsa-miR-513a-5p	CLIP-seq
MIRT2303985	hsa-miR-27a	CLIP-seq
MIRT2303986	hsa-miR-27b	CLIP-seq
MIRT2303988	hsa-miR-3125	CLIP-seq
MIRT2303997	hsa-miR-377	CLIP-seq
MIRT2303999	hsa-miR-3916	CLIP-seq
MIRT2304000	hsa-miR-3940-3p	CLIP-seq
MIRT2077441	hsa-miR-3942-5p	CLIP-seq
MIRT2077444	hsa-miR-4703-5p	CLIP-seq
MIRT2304005	hsa-miR-4712-3p	CLIP-seq
MIRT2304011	hsa-miR-513a-5p	CLIP-seq

Show/Hide all(87)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0004672	Function	Protein kinase activity	IDA	24008408
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	12391145, 18285462
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10770950, 18285462, 19059439
GO:0004697	Function	Protein kinase C activity	ISS
GO:0004698	Function	Calcium-dependent protein kinase C activity	IEA
GO:0004699	Function	Calcium-independent protein kinase C activity	TAS	14583092
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	9139733, 10383400, 10948194, 12628935, 12649167, 12721299, 15591124, 16377624, 16611985, 16940418, 22465666, 22528498, 23814099, 24396867, 24996056, 25241761, 26112605, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IDA	15632189, 15774464, 16611985, 18285462
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	15632189, 16611985, 18285462
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	15774464, 18556656
GO:0005829	Component	Cytosol	IDA	10770950, 15774464, 17303575
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	10770950, 15632189, 17303575
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IEA
GO:0006468	Process	Protein phosphorylation	IDA	10713049, 12649167, 16611985
GO:0006915	Process	Apoptotic process	IDA	10770950, 12649167
GO:0007049	Process	Cell cycle	IEA
GO:0007165	Process	Signal transduction	TAS	8357834
GO:0008047	Function	Enzyme activator activity	IDA	16611985
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	TAS	24522549
GO:0010469	Process	Regulation of signaling receptor activity	TAS	14583092
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0016572	Process	Histone phosphorylation	IDA	19059439
GO:0018105	Process	Peptidyl-serine phosphorylation	IBA	21873635
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	18285462
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	10770950
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IEA
GO:0019899	Function	Enzyme binding	IDA	18556656
GO:0019899	Function	Enzyme binding	IPI	16611985, 19059439
GO:0019900	Function	Kinase binding	IPI	19059439
GO:0019901	Function	Protein kinase binding	IPI	10713049, 28428613
GO:0023021	Process	Termination of signal transduction	IMP	19279008
GO:0030168	Process	Platelet activation	TAS
GO:0030837	Process	Negative regulation of actin filament polymerization	ISS
GO:0032079	Process	Positive regulation of endodeoxyribonuclease activity	IMP	19059439
GO:0032091	Process	Negative regulation of protein binding	TAS	14583092
GO:0032147	Process	Activation of protein kinase activity	IDA	10713049
GO:0032930	Process	Positive regulation of superoxide anion generation	IMP	19801500
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	22554282
GO:0034351	Process	Negative regulation of glial cell apoptotic process	IMP	15774464
GO:0034644	Process	Cellular response to UV	IDA	17303575
GO:0035307	Process	Positive regulation of protein dephosphorylation	IMP	19279008
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0036019	Component	Endolysosome	IDA	17303575
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042100	Process	B cell proliferation	IEA
GO:0042119	Process	Neutrophil activation	IDA	10770950
GO:0042307	Process	Positive regulation of protein import into nucleus	IMP	19059439
GO:0042742	Process	Defense response to bacterium	ISS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043407	Process	Negative regulation of MAP kinase activity	IMP	19279008
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043560	Function	Insulin receptor substrate binding	ISS
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	ISS
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	TAS	14583092
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IC	19279008
GO:0050732	Process	Negative regulation of peptidyl-tyrosine phosphorylation	ISS	14583092
GO:0050821	Process	Protein stabilization	NAS	16611985
GO:0051490	Process	Negative regulation of filopodium assembly	ISS
GO:0060326	Process	Cell chemotaxis	IMP	24008408
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	10713049
GO:0071447	Process	Cellular response to hydroperoxide	IDA	19059439
GO:0090331	Process	Negative regulation of platelet aggregation	ISS
GO:0090398	Process	Cellular senescence	IMP	15282327
GO:0106310	Function	Protein serine kinase activity	IDA	17303575
GO:1900163	Process	Positive regulation of phospholipid scramblase activity	IMP	10770950
GO:1904385	Process	Cellular response to angiotensin	IDA	18285462
GO:2000303	Process	Regulation of ceramide biosynthetic process	IDA	17303575
GO:2000304	Process	Positive regulation of ceramide biosynthetic process	IMP	19279011
GO:2000753	Process	Positive regulation of glucosylceramide catabolic process	IMP	19279011
GO:2000755	Process	Positive regulation of sphingomyelin catabolic process	IMP	19279011
GO:2001022	Process	Positive regulation of response to DNA damage stimulus	IMP	17938203
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
176977	9399	ENSG00000163932

Protein

UniProt ID

Q05655

Protein name

Protein kinase C delta type (EC 2.7.11.13) (Tyrosine-protein kinase PRKCD) (EC 2.7.10.2) (nPKC-delta) [Cleaved into: Protein kinase C delta type regulatory subunit; Protein kinase C delta type catalytic subunit (Sphingosine-dependent protein kinase-1) (SD

Protein function

Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays contrasting roles in cell death and cell survival by functioning as a pro-apoptotic protein during DNA damage-induced apoptosis, but

PDB

1YRK , 2YUU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00130	C1_1	159 → 211	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00130	C1_1	231 → 283	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00069	Pkinase	349 → 603	Protein kinase domain	Domain
PF00433	Pkinase_C	624 → 665	Protein kinase C terminal domain	Family

Sequence

MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR
RSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF
GKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVL
LDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIH
PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAF
AGFSFVNPKFEHLLED

Sequence length

676

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412