PRKAG3 (protein kinase AMP-activated non-catalytic subunit gamma 3)

Gene

• Entrez ID: 53632
• Gene name: Protein kinase AMP-activated non-catalytic subunit gamma 3
• Gene symbol: PRKAG3
• Synonyms: AMPKG3, SMGMQTL
• Chromosome: 2
• Chromosome location: 2q35
• Summary: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs138130157	G>A	Pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1262452	hsa-miR-103a	CLIP-seq
MIRT1262453	hsa-miR-107	CLIP-seq
MIRT1262454	hsa-miR-1184	CLIP-seq
MIRT1262455	hsa-miR-4310	CLIP-seq
MIRT1262456	hsa-miR-4418	CLIP-seq
MIRT1262457	hsa-miR-4452	CLIP-seq
MIRT1262458	hsa-miR-4658	CLIP-seq
MIRT1262459	hsa-miR-4732-3p	CLIP-seq
MIRT1262460	hsa-miR-4758-5p	CLIP-seq
MIRT1262461	hsa-miR-4765	CLIP-seq
MIRT1262462	hsa-miR-509-3-5p	CLIP-seq
MIRT1262463	hsa-miR-509-5p	CLIP-seq
MIRT1262464	hsa-miR-554	CLIP-seq
MIRT1262452	hsa-miR-103a	CLIP-seq
MIRT1262453	hsa-miR-107	CLIP-seq
MIRT2303868	hsa-miR-1178	CLIP-seq
MIRT2303869	hsa-miR-203	CLIP-seq
MIRT2303870	hsa-miR-214	CLIP-seq
MIRT2303871	hsa-miR-302f	CLIP-seq
MIRT2303872	hsa-miR-3619-5p	CLIP-seq
MIRT2303873	hsa-miR-4291	CLIP-seq
MIRT1262455	hsa-miR-4310	CLIP-seq
MIRT2303874	hsa-miR-761	CLIP-seq
MIRT2303875	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 32296183
GO:0005524	Function	ATP binding	IEA
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005978	Process	Glycogen biosynthetic process	IEA
GO:0006096	Process	Glycolytic process	IEA
GO:0006468	Process	Protein phosphorylation	IBA	21873635
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0007050	Process	Cell cycle arrest	TAS
GO:0014873	Process	Response to muscle activity involved in regulation of muscle adaptation	IEA
GO:0016208	Function	AMP binding	IBA	21873635
GO:0016236	Process	Macroautophagy	TAS
GO:0016241	Process	Regulation of macroautophagy	TAS
GO:0019887	Function	Protein kinase regulator activity	IBA	21873635
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0019901	Function	Protein kinase binding	IDA	10698692
GO:0031588	Component	Nucleotide-activated protein kinase complex	IBA	21873635
GO:0035556	Process	Intracellular signal transduction	TAS	10698692
GO:0042149	Process	Cellular response to glucose starvation	IBA	21873635
GO:0050790	Process	Regulation of catalytic activity	IBA	21873635
GO:0071900	Process	Regulation of protein serine/threonine kinase activity	IEA
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS

Other IDs

• MIM: 604976
• HGNC: 9387
• e!Ensembl: ENSG00000115592

Protein

• UniProt ID: Q9UGI9
• Protein name: 5'-AMP-activated protein kinase subunit gamma-3 (AMPK gamma3) (AMPK subunit gamma-3)
• Protein function: AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism (PubMed:14722619, PubMed:17878938, PubMed:24563466). In response to reduction of intra
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00571	CBS	273 → 333	CBS domain	Domain
  PF00571	CBS	352 → 406	CBS domain	Domain
  PF00571	CBS	417 → 479	CBS domain	Domain

• Sequence:

  MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRW
  TRQKSVEEGEPPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSD
  CTASAAGSSTDDVELATEFPATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPG
  AQIYMRFMQEHTCYDAMATSSKLVIFDTMLEIKKAFFALVANGVRAAPLWDSKKQSFVGM
  LTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGCFKPLVSISPNDSLFEAVYTL
  IKNRIHRLPVLDPVSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQDLGIGTFRDLA
  VVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA
  LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLS
  PAGIDALGA

• Sequence length: 489