PRKAG1 (protein kinase AMP-activated non-catalytic subunit gamma 1)

Gene

• Entrez ID: 5571
• Gene name: Protein kinase AMP-activated non-catalytic subunit gamma 1
• Gene symbol: PRKAG1
• Synonyms: AMPKG
• Chromosome: 12
• Chromosome location: 12q13.12
• Summary: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022607	hsa-miR-124-3p	Microarray	18668037
MIRT023779	hsa-miR-1-3p	Proteomics	18668040
MIRT045971	hsa-miR-125b-5p	CLASH	23622248
MIRT037198	hsa-miR-877-3p	CLASH	23622248
MIRT637068	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT637067	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT637066	hsa-miR-3914	HITS-CLIP	23824327
MIRT065258	hsa-miR-873-5p	HITS-CLIP	23824327
MIRT637065	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT637064	hsa-miR-4286	HITS-CLIP	23824327
MIRT637063	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT637062	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT637061	hsa-miR-5193	HITS-CLIP	23824327
MIRT637060	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT637059	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT637068	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT637067	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT637066	hsa-miR-3914	HITS-CLIP	23824327
MIRT065258	hsa-miR-873-5p	HITS-CLIP	23824327
MIRT637065	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT637064	hsa-miR-4286	HITS-CLIP	23824327
MIRT637063	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT637062	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT637061	hsa-miR-5193	HITS-CLIP	23824327
MIRT637060	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT637059	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT573776	hsa-miR-4729	PAR-CLIP	20371350
MIRT573775	hsa-miR-6748-3p	PAR-CLIP	20371350
MIRT573774	hsa-miR-4421	PAR-CLIP	20371350
MIRT573773	hsa-miR-5699-3p	PAR-CLIP	20371350
MIRT573772	hsa-miR-215-3p	PAR-CLIP	20371350
MIRT573771	hsa-miR-145-3p	PAR-CLIP	20371350
MIRT573770	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT573769	hsa-miR-376a-5p	PAR-CLIP	20371350
MIRT573768	hsa-miR-5696	PAR-CLIP	20371350
MIRT573767	hsa-miR-4709-3p	PAR-CLIP	20371350
MIRT573766	hsa-miR-3064-3p	PAR-CLIP	20371350
MIRT573765	hsa-miR-4715-3p	PAR-CLIP	20371350
MIRT573764	hsa-miR-4760-5p	PAR-CLIP	20371350
MIRT573763	hsa-miR-8061	PAR-CLIP	20371350
MIRT573762	hsa-miR-7152-5p	PAR-CLIP	20371350
MIRT573761	hsa-miR-4776-3p	PAR-CLIP	20371350
MIRT439904	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439904	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT637068	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT637067	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT637066	hsa-miR-3914	HITS-CLIP	23824327
MIRT065258	hsa-miR-873-5p	HITS-CLIP	23824327
MIRT637065	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT637064	hsa-miR-4286	HITS-CLIP	23824327
MIRT637063	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT637062	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT637061	hsa-miR-5193	HITS-CLIP	23824327
MIRT637060	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT637059	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT637068	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT637067	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT637066	hsa-miR-3914	HITS-CLIP	23824327
MIRT065258	hsa-miR-873-5p	HITS-CLIP	23824327
MIRT637065	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT637064	hsa-miR-4286	HITS-CLIP	23824327
MIRT637063	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT637062	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT637061	hsa-miR-5193	HITS-CLIP	23824327
MIRT637060	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT637059	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT573776	hsa-miR-4729	PAR-CLIP	20371350
MIRT573775	hsa-miR-6748-3p	PAR-CLIP	20371350
MIRT573774	hsa-miR-4421	PAR-CLIP	20371350
MIRT573773	hsa-miR-5699-3p	PAR-CLIP	20371350
MIRT573772	hsa-miR-215-3p	PAR-CLIP	20371350
MIRT573771	hsa-miR-145-3p	PAR-CLIP	20371350
MIRT573770	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT573769	hsa-miR-376a-5p	PAR-CLIP	20371350
MIRT573768	hsa-miR-5696	PAR-CLIP	20371350
MIRT573767	hsa-miR-4709-3p	PAR-CLIP	20371350
MIRT573766	hsa-miR-3064-3p	PAR-CLIP	20371350
MIRT573765	hsa-miR-4715-3p	PAR-CLIP	20371350
MIRT573764	hsa-miR-4760-5p	PAR-CLIP	20371350
MIRT573763	hsa-miR-8061	PAR-CLIP	20371350
MIRT573762	hsa-miR-7152-5p	PAR-CLIP	20371350
MIRT573761	hsa-miR-4776-3p	PAR-CLIP	20371350
MIRT1262377	hsa-miR-125a-3p	CLIP-seq
MIRT1262378	hsa-miR-1294	CLIP-seq
MIRT1262379	hsa-miR-1297	CLIP-seq
MIRT1262380	hsa-miR-1305	CLIP-seq
MIRT1262381	hsa-miR-26a	CLIP-seq
MIRT1262382	hsa-miR-26b	CLIP-seq
MIRT1262383	hsa-miR-297	CLIP-seq
MIRT1262384	hsa-miR-3929	CLIP-seq
MIRT1262385	hsa-miR-4316	CLIP-seq
MIRT1262386	hsa-miR-4419b	CLIP-seq
MIRT1262387	hsa-miR-4465	CLIP-seq
MIRT1262388	hsa-miR-4478	CLIP-seq
MIRT1262389	hsa-miR-4489	CLIP-seq
MIRT1262390	hsa-miR-4691-5p	CLIP-seq
MIRT1262391	hsa-miR-4694-3p	CLIP-seq
MIRT1262392	hsa-miR-4757-5p	CLIP-seq
MIRT1262393	hsa-miR-4766-5p	CLIP-seq
MIRT1262394	hsa-miR-4794	CLIP-seq
MIRT1262395	hsa-miR-498	CLIP-seq
MIRT1262396	hsa-miR-522	CLIP-seq
MIRT1262397	hsa-miR-552	CLIP-seq
MIRT1262398	hsa-miR-555	CLIP-seq
MIRT1262399	hsa-miR-561	CLIP-seq
MIRT1262400	hsa-miR-567	CLIP-seq
MIRT1262401	hsa-miR-645	CLIP-seq
MIRT1262402	hsa-miR-668	CLIP-seq
MIRT1262403	hsa-miR-892b	CLIP-seq
MIRT1262404	hsa-miR-1207-5p	CLIP-seq
MIRT1262405	hsa-miR-1909	CLIP-seq
MIRT1262406	hsa-miR-3144-5p	CLIP-seq
MIRT1262407	hsa-miR-4725-5p	CLIP-seq
MIRT1262408	hsa-miR-4763-3p	CLIP-seq
MIRT1262409	hsa-miR-504	CLIP-seq
MIRT2077355	hsa-miR-1231	CLIP-seq
MIRT1262378	hsa-miR-1294	CLIP-seq
MIRT2077356	hsa-miR-1303	CLIP-seq
MIRT1262406	hsa-miR-3144-5p	CLIP-seq
MIRT2077357	hsa-miR-383	CLIP-seq
MIRT2077358	hsa-miR-4288	CLIP-seq
MIRT1262385	hsa-miR-4316	CLIP-seq
MIRT2077359	hsa-miR-4450	CLIP-seq
MIRT2077360	hsa-miR-4667-5p	CLIP-seq
MIRT2077361	hsa-miR-4700-5p	CLIP-seq
MIRT1262407	hsa-miR-4725-5p	CLIP-seq
MIRT1262393	hsa-miR-4766-5p	CLIP-seq
MIRT2077362	hsa-miR-4797-5p	CLIP-seq
MIRT1262409	hsa-miR-504	CLIP-seq
MIRT1262398	hsa-miR-555	CLIP-seq
MIRT1262399	hsa-miR-561	CLIP-seq
MIRT2077363	hsa-miR-632	CLIP-seq
MIRT2077364	hsa-miR-637	CLIP-seq
MIRT1262378	hsa-miR-1294	CLIP-seq
MIRT1262390	hsa-miR-4691-5p	CLIP-seq
MIRT1262377	hsa-miR-125a-3p	CLIP-seq
MIRT1262378	hsa-miR-1294	CLIP-seq
MIRT2600746	hsa-miR-1827	CLIP-seq
MIRT2600747	hsa-miR-218	CLIP-seq
MIRT2600748	hsa-miR-2467-3p	CLIP-seq
MIRT2600749	hsa-miR-296-3p	CLIP-seq
MIRT2600750	hsa-miR-3127-5p	CLIP-seq
MIRT2600751	hsa-miR-3185	CLIP-seq
MIRT2600752	hsa-miR-3612	CLIP-seq
MIRT2600753	hsa-miR-3918	CLIP-seq
MIRT2600754	hsa-miR-3942-5p	CLIP-seq
MIRT2600755	hsa-miR-4279	CLIP-seq
MIRT2600756	hsa-miR-4426	CLIP-seq
MIRT2600757	hsa-miR-4443	CLIP-seq
MIRT2077359	hsa-miR-4450	CLIP-seq
MIRT2600758	hsa-miR-4534	CLIP-seq
MIRT2600759	hsa-miR-4647	CLIP-seq
MIRT2600760	hsa-miR-4662b	CLIP-seq
MIRT2077360	hsa-miR-4667-5p	CLIP-seq
MIRT1262390	hsa-miR-4691-5p	CLIP-seq
MIRT1262391	hsa-miR-4694-3p	CLIP-seq
MIRT2077361	hsa-miR-4700-5p	CLIP-seq
MIRT2600761	hsa-miR-4703-5p	CLIP-seq
MIRT1262392	hsa-miR-4757-5p	CLIP-seq
MIRT2600762	hsa-miR-4802-5p	CLIP-seq
MIRT1262396	hsa-miR-522	CLIP-seq
MIRT2600763	hsa-miR-548c-3p	CLIP-seq
MIRT1262397	hsa-miR-552	CLIP-seq
MIRT2077364	hsa-miR-637	CLIP-seq
MIRT2600764	hsa-miR-650	CLIP-seq
MIRT1262402	hsa-miR-668	CLIP-seq
MIRT1262390	hsa-miR-4691-5p	CLIP-seq
MIRT1262402	hsa-miR-668	CLIP-seq
MIRT1262377	hsa-miR-125a-3p	CLIP-seq
MIRT2600746	hsa-miR-1827	CLIP-seq
MIRT2600747	hsa-miR-218	CLIP-seq
MIRT2600748	hsa-miR-2467-3p	CLIP-seq
MIRT2600749	hsa-miR-296-3p	CLIP-seq
MIRT2600750	hsa-miR-3127-5p	CLIP-seq
MIRT2600751	hsa-miR-3185	CLIP-seq
MIRT2600752	hsa-miR-3612	CLIP-seq
MIRT2600753	hsa-miR-3918	CLIP-seq
MIRT2600754	hsa-miR-3942-5p	CLIP-seq
MIRT2600755	hsa-miR-4279	CLIP-seq
MIRT2600756	hsa-miR-4426	CLIP-seq
MIRT2600757	hsa-miR-4443	CLIP-seq
MIRT2600758	hsa-miR-4534	CLIP-seq
MIRT2600759	hsa-miR-4647	CLIP-seq
MIRT2600760	hsa-miR-4662b	CLIP-seq
MIRT1262390	hsa-miR-4691-5p	CLIP-seq
MIRT1262391	hsa-miR-4694-3p	CLIP-seq
MIRT2600761	hsa-miR-4703-5p	CLIP-seq
MIRT1262392	hsa-miR-4757-5p	CLIP-seq
MIRT2600762	hsa-miR-4802-5p	CLIP-seq
MIRT1262396	hsa-miR-522	CLIP-seq
MIRT2600763	hsa-miR-548c-3p	CLIP-seq
MIRT1262397	hsa-miR-552	CLIP-seq
MIRT2600764	hsa-miR-650	CLIP-seq
MIRT1262402	hsa-miR-668	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004672	Function	Protein kinase activity	IDA	17028174
GO:0004691	Function	CAMP-dependent protein kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	16306228, 17028174, 18403135, 18480843, 20562859, 21988832, 22363791, 23455922, 24722188, 25416956, 25852190, 28514442, 28561066, 31515488, 32296183, 32814053
GO:0005524	Function	ATP binding	ISS
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006110	Process	Regulation of glycolytic process	TAS	8663446
GO:0006468	Process	Protein phosphorylation	IBA	21873635
GO:0006468	Process	Protein phosphorylation	IDA	17028174
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0007050	Process	Cell cycle arrest	TAS
GO:0007165	Process	Signal transduction	TAS
GO:0007283	Process	Spermatogenesis	TAS
GO:0008603	Function	CAMP-dependent protein kinase regulator activity	TAS	8663446
GO:0010628	Process	Positive regulation of gene expression	IDA	17028174
GO:0016020	Component	Membrane	HDA	19946888
GO:0016208	Function	AMP binding	IBA	21873635
GO:0016208	Function	AMP binding	ISS
GO:0016236	Process	Macroautophagy	TAS
GO:0016241	Process	Regulation of macroautophagy	TAS
GO:0019887	Function	Protein kinase regulator activity	IBA	21873635
GO:0019887	Function	Protein kinase regulator activity	ISS
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0019901	Function	Protein kinase binding	IDA	10698692
GO:0031588	Component	Nucleotide-activated protein kinase complex	IBA	21873635
GO:0031588	Component	Nucleotide-activated protein kinase complex	ISS
GO:0042149	Process	Cellular response to glucose starvation	IBA	21873635
GO:0043531	Function	ADP binding	ISS
GO:0045860	Process	Positive regulation of protein kinase activity	TAS	8663446
GO:0050790	Process	Regulation of catalytic activity	IBA	21873635
GO:0051170	Process	Import into nucleus	IEA
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:2000479	Process	Regulation of cAMP-dependent protein kinase activity	IEA

Other IDs

• MIM: 602742
• HGNC: 9385
• e!Ensembl: ENSG00000181929

Protein

• UniProt ID: P54619
• Protein name: 5'-AMP-activated protein kinase subunit gamma-1 (AMPK gamma1) (AMPK subunit gamma-1) (AMPKg)
• Protein function: AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism (PubMed:21680840, PubMed:24563466). In response to reduction of intracellular ATP leve
• PDB: 2UV4, 2UV5, 2UV6, 2UV7, 4CFE, 4CFF, 4RER, 4REW, 4ZHX, 5EZV, 5ISO, 6B1U, 6B2E, 6C9F, 6C9G, 6C9H, 6C9J, 7JHG, 7JHH, 7JIJ, 7M74, 7MYJ, 8BIK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00571	CBS	120 → 178	CBS domain	Domain
  PF00571	CBS	185 → 252	CBS domain	Domain
  PF00571	CBS	269 → 324	CBS domain	Domain

• Sequence:

  METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
  FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
  YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
  TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
  YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
  VVVDENDVVKGIVSLSDILQALVLTGGEKKP

• Sequence length: 331