PRKAG1 (protein kinase AMP-activated non-catalytic subunit gamma 1)

Gene

• Entrez ID: 5571
• Gene name: Protein kinase AMP-activated non-catalytic subunit gamma 1
• Gene symbol: PRKAG1
• Synonyms: AMPKG
• Chromosome: 12
• Chromosome location: 12q13.12
• Summary: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit is one of the gamma regulatory subunits of AMPK. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022607	hsa-miR-124-3p	Microarray	18668037
MIRT023779	hsa-miR-1-3p	Proteomics	18668040
MIRT037198	hsa-miR-877-3p	CLASH	23622248
MIRT045971	hsa-miR-125b-5p	CLASH	23622248
MIRT065258	hsa-miR-873-5p	HITS-CLIP	23824327
MIRT439904	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT573761	hsa-miR-4776-3p	PAR-CLIP	20371350
MIRT573762	hsa-miR-7152-5p	PAR-CLIP	20371350
MIRT573763	hsa-miR-8061	PAR-CLIP	20371350
MIRT573764	hsa-miR-4760-5p	PAR-CLIP	20371350
MIRT573765	hsa-miR-4715-3p	PAR-CLIP	20371350
MIRT573766	hsa-miR-3064-3p	PAR-CLIP	20371350
MIRT573767	hsa-miR-4709-3p	PAR-CLIP	20371350
MIRT573768	hsa-miR-5696	PAR-CLIP	20371350
MIRT573769	hsa-miR-376a-5p	PAR-CLIP	20371350
MIRT573770	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT573771	hsa-miR-145-3p	PAR-CLIP	20371350
MIRT573772	hsa-miR-215-3p	PAR-CLIP	20371350
MIRT573773	hsa-miR-5699-3p	PAR-CLIP	20371350
MIRT573774	hsa-miR-4421	PAR-CLIP	20371350
MIRT573775	hsa-miR-6748-3p	PAR-CLIP	20371350
MIRT573776	hsa-miR-4729	PAR-CLIP	20371350
MIRT637059	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT637060	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT637061	hsa-miR-5193	HITS-CLIP	23824327
MIRT637062	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT637063	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT637064	hsa-miR-4286	HITS-CLIP	23824327
MIRT637065	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT637066	hsa-miR-3914	HITS-CLIP	23824327
MIRT637067	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT637068	hsa-miR-6768-5p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004672	Function	Protein kinase activity	IDA	17028174
GO:0004691	Function	CAMP-dependent protein kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	16306228, 17028174, 18403135, 18480843, 20562859, 21988832, 22363791, 23455922, 24722188, 25416956, 25852190, 28514442, 28561066, 31515488, 32296183, 32814053
GO:0005524	Function	ATP binding	ISS
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006110	Process	Regulation of glycolytic process	TAS	8663446
GO:0006468	Process	Protein phosphorylation	IBA	21873635
GO:0006468	Process	Protein phosphorylation	IDA	17028174
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0007050	Process	Cell cycle arrest	TAS
GO:0007165	Process	Signal transduction	TAS
GO:0007283	Process	Spermatogenesis	TAS
GO:0008603	Function	CAMP-dependent protein kinase regulator activity	TAS	8663446
GO:0010628	Process	Positive regulation of gene expression	IDA	17028174
GO:0016020	Component	Membrane	HDA	19946888
GO:0016208	Function	AMP binding	IBA	21873635
GO:0016208	Function	AMP binding	ISS
GO:0016236	Process	Macroautophagy	TAS
GO:0016241	Process	Regulation of macroautophagy	TAS
GO:0019887	Function	Protein kinase regulator activity	IBA	21873635
GO:0019887	Function	Protein kinase regulator activity	ISS
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0019901	Function	Protein kinase binding	IDA	10698692
GO:0031588	Component	Nucleotide-activated protein kinase complex	IBA	21873635
GO:0031588	Component	Nucleotide-activated protein kinase complex	ISS
GO:0042149	Process	Cellular response to glucose starvation	IBA	21873635
GO:0043531	Function	ADP binding	ISS
GO:0045860	Process	Positive regulation of protein kinase activity	TAS	8663446
GO:0050790	Process	Regulation of catalytic activity	IBA	21873635
GO:0051170	Process	Import into nucleus	IEA
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:2000479	Process	Regulation of cAMP-dependent protein kinase activity	IEA

Other IDs

• MIM: 602742
• HGNC: 9385
• e!Ensembl: ENSG00000181929

Protein

• UniProt ID: P54619
• Protein name: 5'-AMP-activated protein kinase subunit gamma-1 (AMPK gamma1) (AMPK subunit gamma-1) (AMPKg)
• Protein function: AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive.
• PDB: 2UV4, 2UV5, 2UV6, 2UV7, 4CFE, 4CFF, 4RER, 4REW, 4ZHX, 5EZV, 5ISO, 6B1U, 6B2E, 6C9F, 6C9G, 6C9H, 6C9J
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00571	CBS	120 → 178	CBS domain	Domain
  PF00571	CBS	185 → 252	CBS domain	Domain
  PF00571	CBS	269 → 324	CBS domain	Domain

• Sequence:

  METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
  FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
  YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
  TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
  YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
  VVVDENDVVKGIVSLSDILQALVLTGGEKKP

• Sequence length: 331