PRKACG (protein kinase cAMP-activated catalytic subunit gamma)

Gene

• Entrez ID: 5568
• Gene name: Protein kinase cAMP-activated catalytic subunit gamma
• Gene symbol: PRKACG
• Synonyms: BDPLT19, KAPG, PKACg
• Chromosome: 9
• Chromosome location: 9q21.11
• Summary: Cyclic AMP-dependent protein kinase (PKA) consists of two catalytic subunits and a regulatory subunit dimer. This gene encodes the gamma form of its catalytic subunit. The gene is intronless and is thought to be a retrotransposon derived from the gene for the alpha form of the PKA catalytic subunit. [provided by RefSeq, Jul 2008]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs724159972	G>C	Pathogenic	Missense variant, coding sequence variant

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0003091	Process	Renal water homeostasis	TAS
GO:0004679	Function	AMP-activated protein kinase activity	IEA
GO:0004691	Function	CAMP-dependent protein kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IEA
GO:0007283	Process	Spermatogenesis	TAS	9598317
GO:0007596	Process	Blood coagulation	TAS
GO:0008584	Process	Male gonad development	TAS	9598317
GO:0010737	Process	Protein kinase A signaling	IBA	21873635
GO:0034199	Process	Activation of protein kinase A activity	TAS
GO:0034237	Function	Protein kinase A regulatory subunit binding	IBA	21873635
GO:0034380	Process	High-density lipoprotein particle assembly	TAS
GO:0071377	Process	Cellular response to glucagon stimulus	TAS
GO:0097546	Component	Ciliary base	TAS

Other IDs

• MIM: 176893
• HGNC: 9382
• e!Ensembl: ENSG00000165059

Protein

• UniProt ID: P22612
• Protein name: cAMP-dependent protein kinase catalytic subunit gamma (PKA C-gamma) (EC 2.7.11.11)
• Protein function: Phosphorylates a large number of substrates in the cytoplasm and the nucleus.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	44 → 298	Protein kinase domain	Domain

• Sequence:

  MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
  VRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
  MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGY
  LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFY
  ADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
  TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF

• Sequence length: 351