PRKAB2 (protein kinase AMP-activated non-catalytic subunit beta 2)

Gene

• Entrez ID: 5565
• Gene name: Protein kinase AMP-activated non-catalytic subunit beta 2
• Gene symbol: PRKAB2
• Synonyms: -
• Chromosome: 1
• Chromosome location: 1q21.1
• Summary: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2013]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020411	hsa-miR-29c-3p	Sequencing	20371350
MIRT027116	hsa-miR-103a-3p	Sequencing	20371350
MIRT030833	hsa-miR-21-5p	Microarray	18591254
MIRT031580	hsa-miR-16-5p	Sequencing	20371350
MIRT039810	hsa-miR-615-3p	CLASH	23622248
MIRT045002	hsa-miR-186-5p	CLASH	23622248
MIRT047852	hsa-miR-30c-5p	CLASH	23622248
MIRT332934	hsa-miR-3921	PAR-CLIP	21572407
MIRT332935	hsa-miR-4653-5p	PAR-CLIP	21572407
MIRT546969	hsa-miR-580-3p	PAR-CLIP	21572407
MIRT546970	hsa-miR-5687	PAR-CLIP	21572407
MIRT546971	hsa-miR-6761-5p	PAR-CLIP	21572407
MIRT546972	hsa-miR-4329	PAR-CLIP	21572407
MIRT546973	hsa-miR-4251	PAR-CLIP	21572407
MIRT546974	hsa-miR-301b-5p	PAR-CLIP	21572407
MIRT546975	hsa-miR-301a-5p	PAR-CLIP	21572407
MIRT546976	hsa-miR-146a-3p	PAR-CLIP	21572407
MIRT546977	hsa-miR-3668	PAR-CLIP	21572407
MIRT546978	hsa-miR-5680	PAR-CLIP	21572407
MIRT546979	hsa-miR-216b-5p	PAR-CLIP	21572407
MIRT715076	hsa-miR-450a-1-3p	HITS-CLIP	19536157
MIRT715077	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT715078	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT715079	hsa-miR-597-3p	HITS-CLIP	19536157
MIRT715080	hsa-miR-8059	HITS-CLIP	19536157
MIRT715081	hsa-miR-4471	HITS-CLIP	19536157
MIRT715082	hsa-miR-1292-5p	HITS-CLIP	19536157
MIRT715083	hsa-miR-4803	HITS-CLIP	19536157

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004679	Function	AMP-activated protein kinase activity	IDA	21399626
GO:0005515	Function	Protein binding	IPI	16306228, 20562859, 21516116, 21988832, 22363791, 23455922, 24722188, 25416956, 25852190, 27107012, 28514442, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006853	Process	Carnitine shuttle	TAS
GO:0007050	Process	Cell cycle arrest	TAS
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	9575201
GO:0016236	Process	Macroautophagy	TAS
GO:0016241	Process	Regulation of macroautophagy	TAS
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0031588	Component	Nucleotide-activated protein kinase complex	IBA	21873635
GO:0031588	Component	Nucleotide-activated protein kinase complex	IDA	17851531, 21399626
GO:0042304	Process	Regulation of fatty acid biosynthetic process	TAS
GO:0042802	Function	Identical protein binding	IPI	20562859, 21988832
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0080090	Process	Regulation of primary metabolic process	IBA	21873635
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	27411013
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS

Other IDs

• MIM: 602741
• HGNC: 9379
• e!Ensembl: ENSG00000131791

Protein

• UniProt ID: O43741
• Protein name: 5'-AMP-activated protein kinase subunit beta-2 (AMPK subunit beta-2)
• Protein function: Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3).
• PDB: 2F15, 2V8Q, 2V92, 2V9J, 2Y8L, 2Y8Q, 2YA3, 4CFH, 4EAI, 4EAJ, 4RER, 4REW, 6B2E
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16561	AMPK1_CBM	77 → 161	Glycogen recognition site of AMP-activated protein kinase	Family
  PF04739	AMPKBI	201 → 271		Family

• Sequence:

  MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
  SWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
  GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRD
  LSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
  LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI

• Sequence length: 272