PRKAB1 (protein kinase AMP-activated non-catalytic subunit beta 1)

Gene

• Entrez ID: 5564
• Gene name: Protein kinase AMP-activated non-catalytic subunit beta 1
• Gene symbol: PRKAB1
• Synonyms: AMPK, HAMPKb
• Chromosome: 12
• Chromosome location: 12q24.23
• Summary: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004527	hsa-miR-122-5p	Luciferase reporter assay	16459310
MIRT053237	hsa-miR-148b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23171948
MIRT650651	hsa-miR-578	HITS-CLIP	23824327
MIRT650652	hsa-miR-4715-3p	HITS-CLIP	23824327
MIRT650653	hsa-miR-4727-5p	HITS-CLIP	23824327
MIRT650654	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT650655	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT650655	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT650656	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT650657	hsa-miR-432-5p	HITS-CLIP	23824327
MIRT650658	hsa-miR-6817-5p	HITS-CLIP	23824327
MIRT650659	hsa-miR-4769-3p	HITS-CLIP	23824327
MIRT650660	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT650660	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT650661	hsa-miR-4469	HITS-CLIP	23824327
MIRT650661	hsa-miR-4469	HITS-CLIP	19536157
MIRT650662	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT650662	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT650663	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT719917	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT719918	hsa-miR-4713-5p	HITS-CLIP	19536157
MIRT719919	hsa-miR-1260b	HITS-CLIP	19536157
MIRT719920	hsa-miR-1260a	HITS-CLIP	19536157
MIRT719921	hsa-miR-2116-3p	HITS-CLIP	19536157
MIRT719922	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT719923	hsa-miR-150-5p	HITS-CLIP	19536157
MIRT719924	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT719925	hsa-miR-665	HITS-CLIP	19536157
MIRT719926	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT719927	hsa-miR-4733-3p	HITS-CLIP	19536157
MIRT733406	hsa-miR-101-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27145268

Transcription factors

Transcription factor	Regulation	Reference
TP53	Unknown	12771025

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004672	Function	Protein kinase activity	IDA	17028174
GO:0005515	Function	Protein binding	IPI	16306228, 17028174, 18403135, 18480843, 18624398, 20562859, 21072212, 21988832, 22363791, 23455922, 25686248, 25852190, 28514442, 28561066, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	17028174
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0007050	Process	Cell cycle arrest	TAS
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	9575201
GO:0010628	Process	Positive regulation of gene expression	IDA	17028174
GO:0016236	Process	Macroautophagy	TAS
GO:0016241	Process	Regulation of macroautophagy	TAS
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0031588	Component	Nucleotide-activated protein kinase complex	IBA	21873635
GO:0035878	Process	Nail development	IEA
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0080090	Process	Regulation of primary metabolic process	IBA	21873635
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	27411013
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS

Other IDs

• MIM: 602740
• HGNC: 9378
• e!Ensembl: ENSG00000111725

Protein

• UniProt ID: Q9Y478
• Protein name: 5'-AMP-activated protein kinase subunit beta-1 (AMPK subunit beta-1) (AMPKb)
• Protein function: Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3).
• PDB: 4CFE, 4CFF, 4ZHX, 5EZV, 5ISO, 6B1U, 6C9F, 6C9G, 6C9H, 6C9J
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16561	AMPK1_CBM	78 → 161	Glycogen recognition site of AMP-activated protein kinase	Family
  PF04739	AMPKBI	199 → 269		Family

• Sequence:

  MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
  LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
  GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
  SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
  ALSIKDGVMVLSATHRYKKKYVTTLLYKPI

• Sequence length: 270